Align The galacturonic acid (galacturonate) uptake porter, GatA, of 518 aas and 12 TMSs (characterized)
to candidate 353923 BT4397 xylose/H+ symporter (NCBI ptt file)
Query= TCDB::A2R3H2 (518 letters) >FitnessBrowser__Btheta:353923 Length = 460 Score = 170 bits (430), Expect = 1e-46 Identities = 139/488 (28%), Positives = 227/488 (46%), Gaps = 50/488 (10%) Query: 4 LKNYR---VYLLTAVAYSGSLLFGYDTGVMGSVLSLTSFKEDFGIPTGSSGFASSKSSEI 60 +K+Y VY + V+ G LLFGYD V+G ++ FGI + S + Sbjct: 1 MKSYNKKFVYSICLVSAMGGLLFGYDWVVIGGAKPF--YELYFGI---------ADSPTM 49 Query: 61 SSNVVSLLTAGCFFGAIFAAPLNERIGRRYALMIFTVIFLIGAAVQVASKHHIGQIYGGR 120 +S+ GC GA+ A + +R GR+ L+I IFL +A + R Sbjct: 50 QGLAMSVALLGCLIGAMVAGMMADRYGRKPLLLISAFIFL-SSAYATGAFSVFSWFLAAR 108 Query: 121 VIAGLGIGGMSSITPVFVSENCPPSIRGRVAGMFQEFLVIGSTFAYWLDYGVSLHIPSST 180 + G+GIG S ++P++++E P SIRG++ + Q +V+G A ++ ++ IP+ Sbjct: 109 FLGGIGIGIASGLSPMYIAEVAPTSIRGKLVSLNQLTIVLGILGAQIANWLIAEPIPADF 168 Query: 181 KQ------------WRVPVAVQLIPGGLMLLGLFFLKESPRWLAGKGRHEEALQSLAYIR 228 WR P + LL F+ ESPRWLA KG+ E+A L+ I Sbjct: 169 TPADICASWNGQMGWRWMFWGAAFPAAVFLLLACFIPESPRWLAMKGKREKAWSVLSRIG 228 Query: 229 NESPDSEEIQKEFAEIRAAIDEEVAA-TEGLTYKEFIQPSNLKRFGFAFTLMLSQQFTGT 287 +E+Q +++ A+ +EG F +P K + + QQ+ GT Sbjct: 229 GNRYAEQELQM--------VEQTSASKSEGGLKLLFSRPFR-KVLVLGVIVAVFQQWCGT 279 Query: 288 NSIGYYAPEIFQTIGLSATNSSLFATGVYGTVKVVATAIFLFVGIDRWGRKLSLVGGSIW 347 N I YA EIFQ+ G S LF V G V+ T + ++ ++R GR+ ++ G+ Sbjct: 280 NVIFNYAQEIFQSAGYSL-GDVLFNIVVTGVANVIFTFVAIYT-VERLGRRALMLLGAGG 337 Query: 348 MASMMFIIGAVLATHPPDTSASGVSQASIAMVVMIYLYVIGYSASWGPTPWVYVSEIFPT 407 +A + ++G + MVV++ L + Y+ S GP WV ++EIFP Sbjct: 338 LAGIYLVLGTCYF----------FQVSGFFMVVLVVLAIACYAMSLGPITWVLLAEIFPN 387 Query: 408 RLRSYGVGLAATSQWLWSFVVTEITPKAVHNIG-WRTFLMFGIFCVAMCVFVIVFAKETK 466 R+R + + W+ SF +T P +G + TF ++ CV +F + ETK Sbjct: 388 RVRGVAMATCTFALWVGSFTLTYTFPLLNTALGSYGTFWIYSAICVFGFLFFLRALPETK 447 Query: 467 GRSLEDMD 474 G+SLE ++ Sbjct: 448 GKSLETLE 455 Lambda K H 0.323 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 46 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 518 Length of database: 460 Length adjustment: 34 Effective length of query: 484 Effective length of database: 426 Effective search space: 206184 Effective search space used: 206184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory