Align Glucosamine-6-phosphate deaminase; EC 3.5.99.6; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase (uncharacterized)
to candidate 353113 BT3587 glucosamine-6-phosphate isomerase (NCBI ptt file)
Query= curated2:B7H945 (262 letters) >FitnessBrowser__Btheta:353113 Length = 261 Score = 139 bits (351), Expect = 5e-38 Identities = 76/215 (35%), Positives = 123/215 (57%), Gaps = 6/215 (2%) Query: 22 EVVKTKENPTLGMATGSSPLGIYAEMRKNK-LDTSRVTTVNLDEYVNLPHEDKNSYHYFM 80 E++K K + A S + + +K +D SR+ ++DEY+ + E S+ F+ Sbjct: 41 ELLKEKAEINMIFAAAPSQNEFLSHLIHSKQIDWSRINAFHMDEYIGIHPEAPQSFGNFL 100 Query: 81 QEQLFDHLPFKQTYVPNGMASDLEEECKRYESILAANPVDLQILGIGENGHIGFNEPGTP 140 ++++FD +PFK NG A +LEEECKRY +L +PVD+ LGIGENGHI FN+P Sbjct: 101 RQRIFDKVPFKTVNYLNGQAENLEEECKRYSELLLRHPVDIVCLGIGENGHIAFNDPDVA 160 Query: 141 FNSPTNIVELTE-----STRQANLRFFEKEEDVPTHAITMGIGSIMKAKQVLLVAMGSKK 195 + +++V++ E +Q N + FE + VP A+T+ I +++KA + + K Sbjct: 161 NFNDSHLVKVVELDPICRQQQVNEKCFEAFDLVPAKALTLTIPALLKADWMFCIVPFKNK 220 Query: 196 AEAVKELLQGEYSEECPATVLQRHPNVTVIADQEA 230 A AV L GE SE+CPA++L++ N + D E+ Sbjct: 221 ANAVYNTLYGEISEKCPASILRKKENSCLYLDPES 255 Lambda K H 0.313 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 261 Length adjustment: 25 Effective length of query: 237 Effective length of database: 236 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory