Align N-acetylglucosamine kinase (EC 2.7.1.59) (characterized)
to candidate 349961 BT0433 putative xylose repressor (NCBI ptt file)
Query= metacyc::MONOMER-19002 (326 letters) >FitnessBrowser__Btheta:349961 Length = 402 Score = 149 bits (377), Expect = 9e-41 Identities = 102/321 (31%), Positives = 152/321 (47%), Gaps = 16/321 (4%) Query: 6 EKPYVVGIDIGGTNTVFGIVDARGTIIASGAVKTQVYPTVEEYADEVCKNLLPLIIANG- 64 E Y +G+DI G+++ +G ++ + E +E+CK +L I Sbjct: 83 ESGYFIGVDIKRFAVNIGLINFKGDMVELKMNIPYKFENSIEGMNELCKLILNFIKKLPI 142 Query: 65 GVDKIKGIGIGA-----PNGNYYTGTIEFAPNLPWKGVLPLASMFEERLGIPTALTNDAN 119 +KI I + P Y F PLA + E+LG + ND Sbjct: 143 NKEKILNINVNVSGWVNPESGYSFSQFNFEER-------PLADVLSEKLGHKVTIDNDTR 195 Query: 120 AAAVGEMTYGAARGMKDFIMITLGTGVGSGIVINGQVVYGHDGFAGELGHVIVRRDGRIC 179 A GE G +G KD I + + GVG GI+I+G+V G GF+GE GHV + IC Sbjct: 196 AMTYGEYMQGCVKGEKDIIFVNVSWGVGIGIIIDGKVYTGKSGFSGEFGHVNAYDNEIIC 255 Query: 180 GCGRKGCLETYCSATGVARTAREFLAARTDASLLRNIPAES--IVSKDVYDAAVQGDKLA 237 CG+KGCLET S + + R E + + + L I E I ++ A + D L Sbjct: 256 HCGKKGCLETEASGSALHRILLERIKSGESSILSTRISGEEDPITLDEIITAVNKEDLLC 315 Query: 238 QEIFEFTGNILGEALADAIAFSSPEAIILFGGLAKSGDYIMKPIMKAMENNLLNIYKGKA 297 EI E G LG+ +A I +PE +I+ G L+ +GDYI +PI A+ LN+ + Sbjct: 316 IEIVEEIGQKLGKQIAGLINIFNPELVIIGGTLSLTGDYITQPIKTAVRKYSLNLVNKDS 375 Query: 298 KLLVSELKDSDAAVLGASALA 318 ++ S+LKD A ++GA LA Sbjct: 376 AIITSKLKDK-AGIVGACMLA 395 Lambda K H 0.318 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 402 Length adjustment: 29 Effective length of query: 297 Effective length of database: 373 Effective search space: 110781 Effective search space used: 110781 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory