Align glycerate 2-kinase (EC 2.7.1.165) (characterized)
to candidate 350965 BT1437 conserved hypothetical protein (NCBI ptt file)
Query= BRENDA::P23524 (381 letters) >FitnessBrowser__Btheta:350965 Length = 377 Score = 315 bits (808), Expect = 1e-90 Identities = 163/370 (44%), Positives = 235/370 (63%), Gaps = 3/370 (0%) Query: 2 KIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAER 61 K+V+A D +K LS+SEV +A+E+G + + PD + + P+ADGGEG + ++ AT+G + Sbjct: 3 KVVVAMDFFKGCLSSSEVEKAVEEGIKLVCPDCEVIRFPIADGGEGILTVLVEATRGTYQ 62 Query: 62 HAWVTGPLGEKVNASWGISGDGKTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELILQA 121 PL + ++G+SGD + AFIEMA +GL L+ +R+P++TT+ GTGELIL A Sbjct: 63 KIIANDPLMRPIETTYGVSGDKRVAFIEMATVNGLPLLSETERNPMLTTTYGTGELILHA 122 Query: 122 LESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDISGLDP 181 +E G +IGIGGSATND G GM+QALGA+ + +G +G GG L+ + ID S + P Sbjct: 123 IEQGYREFVIGIGGSATNDAGVGMLQALGARFLNKDGAVLGEGGEILHRIAAIDFSSVHP 182 Query: 182 RLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKALHVDV 241 L+D +ACDV NP G GA+ +F QKGA +AMI +LD + ++ +I ++ Sbjct: 183 ALEDTRFTIACDVRNPFCGPEGAAHVFARQKGADDAMIEKLDAGMQSFSRLIHSTTGREI 242 Query: 242 KDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDSQSIH 301 VPGAGAAGG+G A +AFL AELK GI+++ L E I L+ITGEGR D QS+ Sbjct: 243 THVPGAGAAGGLGGAFLAFLNAELKPGIDLLLQTLKFSEKIKGADLIITGEGRTDRQSLM 302 Query: 302 GKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRG--AY 359 GKVP G+ AK+ PVI +AGS+ +D +++Q G +FS++ S +L+ A + A Sbjct: 303 GKVPSGILEEAKRQGIPVIVVAGSI-EDTEILNQAGFQGLFSIIPSPMSLETAMKPEVAK 361 Query: 360 DNICRASRNI 369 NICR I Sbjct: 362 KNICRTVAQI 371 Lambda K H 0.315 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 377 Length adjustment: 30 Effective length of query: 351 Effective length of database: 347 Effective search space: 121797 Effective search space used: 121797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory