Align Glutamate mutase sigma subunit; Glutamate mutase S chain; Glutamate mutase small subunit; Methylaspartate mutase; EC 5.4.99.1 (characterized)
to candidate 349868 BT0340 trimethylamine corrinoid protein 2 (TCP 2) (NCBI ptt file)
Query= SwissProt::Q05488 (137 letters) >FitnessBrowser__Btheta:349868 Length = 602 Score = 56.2 bits (134), Expect = 8e-13 Identities = 27/88 (30%), Positives = 49/88 (55%), Gaps = 1/88 (1%) Query: 6 IVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYG 65 IV+G + D H +G ++ GF V+NIG+ + + F+ A E KAD++C+S+L Sbjct: 480 IVIGTVKGDLHDIGKNLVASMLEGCGFEVINIGIDVTCDKFVEAVKENKADILCMSALLT 539 Query: 66 QGEIDCKGLREKCDEAGLKG-IKLFVGG 92 + + +EAG++ +K+ +GG Sbjct: 540 TTMTYMQDVIRALEEAGIRDQVKVMIGG 567 Lambda K H 0.318 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 137 Length of database: 602 Length adjustment: 26 Effective length of query: 111 Effective length of database: 576 Effective search space: 63936 Effective search space used: 63936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory