Align ABC transporter for L-Histidine, permease component (characterized)
to candidate 351278 BT1750 glycine betaine/L-proline transport system permease (NCBI ptt file)
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >FitnessBrowser__Btheta:351278 Length = 276 Score = 256 bits (653), Expect = 5e-73 Identities = 131/275 (47%), Positives = 188/275 (68%), Gaps = 1/275 (0%) Query: 9 SIADWVNGWVDSLVTNYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLAIVGGIAWHATR 68 +I ++ ++ L ++ F +S + I + +L P+++ +A++ +AW + Sbjct: 3 NIGQYIETAINWLTEHFASFFDALSMGIGGFIDGFQHVLFGIPFYITIAVLAALAWFKSG 62 Query: 69 KVLATAVIVGLLFLVGAVGLWDKLMQTLALMLVATLISVLIGIPLGILSARSNRLRSVLM 128 K A ++GLL + G +G W++ MQTLAL+L +T +++L+G+PLGI +A S+R ++ Sbjct: 63 KGTAVFTLLGLLLIYG-MGFWEETMQTLALVLSSTCLALLLGVPLGIWTANSDRCNKIMR 121 Query: 129 PLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAI 188 P+LD MQTMP+FVYLIP ++ FGLG VP FAT+I+A PP++RLT LGIRQV V+EA Sbjct: 122 PVLDFMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPKNVVEAS 181 Query: 189 NAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQTL 248 +FGA WQ L+ VQLPLALP+I+ GINQT MM+LSMVVIA+MI A GLGE VL GI + Sbjct: 182 RSFGATPWQLLYKVQLPLALPTILTGINQTIMMSLSMVVIAAMISAGGLGEIVLKGITQM 241 Query: 249 NVGRGLEAGLAIVILAVVIDRITQAYGRPRHEVSK 283 +G G E G+A+VILA+V+DRITQ R K Sbjct: 242 KIGLGFEGGIAVVILAIVLDRITQGMADNRKSKKK 276 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 276 Length adjustment: 26 Effective length of query: 257 Effective length of database: 250 Effective search space: 64250 Effective search space used: 64250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory