Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 353363 BT3837 ABC transporter ATP-binding protein (NCBI ptt file)
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Btheta:353363 Length = 255 Score = 125 bits (313), Expect = 1e-33 Identities = 77/254 (30%), Positives = 127/254 (50%), Gaps = 16/254 (6%) Query: 15 ESSLLL-AQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQG 73 ES ++L + L K +G V H I VK+G I GL+GPNGAGKTT F + I P++G Sbjct: 3 ESKMVLRTEDLVKKYGKRTVVSHVSIDVKQGEIVGLLGPNGAGKTTSFYMTVGLITPNEG 62 Query: 74 EVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINF 133 + + I + ++ A G Q A V +++V +N+ Sbjct: 63 RIFLDDLEITKFPVYKRAQTGIGYLAQEASVFRQMSVEDNIASV---------------L 107 Query: 134 RRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEP 193 K + ++K +++ L ++ LSGG+R+ E+AR L +PK I+LDEP Sbjct: 108 EMTNKPKDYQKDKLESLIAEFRLQKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEP 167 Query: 194 AAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQI 253 AGV+P + I + + + I L+ +HN+ +++ ++L EG+ L GTPE++ Sbjct: 168 FAGVDPIAVEDIQQIVWKLKDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEEL 227 Query: 254 QSDPRVLEAYLGDS 267 + V E YL +S Sbjct: 228 AENKIVREKYLSNS 241 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 255 Length adjustment: 25 Effective length of query: 242 Effective length of database: 230 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory