Align Ketoisovalerate oxidoreductase subunit VorB; VOR; 2-oxoisovalerate ferredoxin reductase subunit beta; 2-oxoisovalerate oxidoreductase beta chain; EC 1.2.7.7 (characterized)
to candidate 349859 BT0331 ketoisovalerate oxidoreductase subunit vorB (NCBI ptt file)
Query= SwissProt::P80908 (352 letters) >FitnessBrowser__Btheta:349859 Length = 295 Score = 266 bits (680), Expect = 5e-76 Identities = 149/291 (51%), Positives = 194/291 (66%), Gaps = 7/291 (2%) Query: 62 MVYGAAAAGHRVMTASSGPGMSLKQEGISFLAGAELPAVIVDVMRAGPGLGNIGPEQADY 121 MVYG A +G V+T+SS PG+SLKQEGIS++AGAELP +IV+VMR GPGLG I P QADY Sbjct: 1 MVYGGAGSGKMVLTSSSSPGVSLKQEGISYIAGAELPCLIVNVMRGGPGLGTIQPSQADY 60 Query: 122 NQLVKGGGHGNYRNIVLAPNSVQEMCDLTMDAFELADKYRNPVIILADAVLGQMAE---- 177 Q VKGGGHG+YR I LAP SVQEM D FELA KYRNP IILAD V+GQM E Sbjct: 61 FQTVKGGGHGDYRLIALAPASVQEMADFVALGFELAFKYRNPAIILADGVIGQMMEKVVL 120 Query: 178 PLRFPERA-VEHRPDTSWAVCGSRETMK-NLVTSIFLDFDELEEFNFYLQEKYAAVEENE 235 P + P R E WA G + K N++TS+ L + +E N Q KY +EENE Sbjct: 121 PAQKPRRTDAEVIEQCPWAATGKAKGRKPNIITSLELKPEAMEINNIRFQAKYKQIEENE 180 Query: 236 VRYEEYMVEDAEIVLVAYGISSRVAKSAVDTARADGIKVGLLRPITLFPFPSERIRELAE 295 VR+EE EDAE ++VA+G +R+ + A++ AR GIKVG+LRPITL+PFPS+ I A+ Sbjct: 181 VRFEEINCEDAEYLIVAFGSMARIGQKAMELAREKGIKVGILRPITLWPFPSKAIAAYAD 240 Query: 296 GGCTFISVEMSSGQMREDIKMA-SGCRDVELVNRMGGNLIELRDILRKIRE 345 + E+++GQM ED+++A +G VE R+GG + + +I+ + E Sbjct: 241 KVKGMLVTELNAGQMIEDVRLAVNGKVKVEHFGRLGGIVPDPDEIVTALEE 291 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 295 Length adjustment: 28 Effective length of query: 324 Effective length of database: 267 Effective search space: 86508 Effective search space used: 86508 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory