Align Galactokinase (EC 2.7.1.6) (characterized)
to candidate 349898 BT0370 galactokinase (NCBI ptt file)
Query= reanno::Pedo557:CA265_RS06125 (383 letters) >lcl|FitnessBrowser__Btheta:349898 BT0370 galactokinase (NCBI ptt file) Length = 384 Score = 333 bits (854), Expect = 5e-96 Identities = 170/381 (44%), Positives = 239/381 (62%), Gaps = 3/381 (0%) Query: 1 MNAQHLKNTFKKLFNAEP-ILVRSPGRINIIGEHTDYNGGFVMPAAIDKAIYVAISKRGD 59 M+ +H+++ F K F+ + SPGRIN+IGEHTDYNGGFV P A+DK + I G Sbjct: 1 MDIEHVRSRFIKHFDGTTGFIYASPGRINLIGEHTDYNGGFVFPGAVDKGMLAEIKPNGT 60 Query: 60 DEIHLFSESYQQFDISSINSLKKSENSWANYILGIADQLKERGYQLGGFNFYIDGDVPLG 119 D++ +S + + +N SWA YI G+ ++ +RG + GFN GDVPLG Sbjct: 61 DKVRAYSIDLKDYVEFGLNEEDAPRASWARYIFGVCREMIKRGVDVKGFNTAFSGDVPLG 120 Query: 120 AGLSSSAAVECATGFALDQLFSLS-VSRMDIALIAQKAEQTFAGVNCGIMDQFASVFGKK 178 AG+SSSAA+E FAL++LF + + ++A + Q E + GVNCGIMDQFASVFGK Sbjct: 121 AGMSSSAALESTYAFALNELFGEGKIDKFELAKVGQATEHNYCGVNCGIMDQFASVFGKA 180 Query: 179 DQAIMLDCRSMKHIYIPLKLDGYKLLLLNTNVKHALADSAYNKRRSQCEQGVAWVKAHYP 238 I LDCRS+++ Y P +GY+L+L+++ VKH LA SAYNKRR CE VA ++ +P Sbjct: 181 GSLIRLDCRSLEYQYFPFHPEGYRLVLMDSVVKHELASSAYNKRRQSCEAAVAAIQKKHP 240 Query: 239 NVSTLRDVDLTMLETYVKPMDLEVYNKCRFVVEEIGRLLTAAEQLENGNLQALGKLMFET 298 +V LRD + MLE ++ E Y + +V+EEI R+L + LE + + +G+ M+ET Sbjct: 241 HVEFLRDCTMDMLEEAKADINAEDYMRAEYVIEEIQRVLDVCDALEKDDYETVGQKMYET 300 Query: 299 HEGLSKDYEVSCKELDFLVEAVKPLDYVLGARMMGGGFGGCTINIVKEEKIADLVEELSS 358 H G+SK YEVSC+ELDFL + K V G+R+MGGGFGGCTIN+VK E + VE+ Sbjct: 301 HHGMSKLYEVSCEELDFLNDCAKEYG-VTGSRVMGGGFGGCTINLVKNELYDNFVEKTKE 359 Query: 359 KYLLQFGLKLDSYTVQTDNGT 379 + +FG Y V +G+ Sbjct: 360 AFKAKFGRSPKVYDVVIGDGS 380 Lambda K H 0.319 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 384 Length adjustment: 30 Effective length of query: 353 Effective length of database: 354 Effective search space: 124962 Effective search space used: 124962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 349898 BT0370 (galactokinase (NCBI ptt file))
to HMM TIGR00131 (galK: galactokinase (EC 2.7.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00131.hmm # target sequence database: /tmp/gapView.27274.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00131 [M=388] Accession: TIGR00131 Description: gal_kin: galactokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-94 300.7 0.1 8.5e-94 300.5 0.1 1.0 1 lcl|FitnessBrowser__Btheta:349898 BT0370 galactokinase (NCBI ptt f Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:349898 BT0370 galactokinase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 300.5 0.1 8.5e-94 8.5e-94 2 387 .. 4 382 .. 3 383 .. 0.93 Alignments for each domain: == domain 1 score: 300.5 bits; conditional E-value: 8.5e-94 TIGR00131 2 eevkkiFasaykekpdlvvraPGRvnliGehiDYndgsvlPlaidvdtlvavkerddknvsitlanadnklaerkl 77 e+v++ F++ ++ +++ +PGR+nliGeh+DYn+g+v+P a+d ++l+ +k +v+ ++++++ + e+ l lcl|FitnessBrowser__Btheta:349898 4 EHVRSRFIKHFDGTTGFIYASPGRINLIGEHTDYNGGFVFPGAVDKGMLAEIKPNGTDKVRAYSIDLK-DYVEFGL 78 678999*************************************************************9.6677888 PP TIGR00131 78 dlpldksevsdWanYvkgvlkvlqeRfnsvplGldivisgdvPtgaGLsssaalevavaavlk.nlgkleldskei 152 + + + Wa Y+ gv +++ +R +v+ G++ +sgdvP gaG+sssaale a l+ +g+++ d+ e lcl|FitnessBrowser__Btheta:349898 79 NEEDAPR--ASWARYIFGVCREMIKRGVDVK-GFNTAFSGDVPLGAGMSSSAALESTYAFALNeLFGEGKIDKFEL 151 7765555..59*******************9.***************************88883556778888899 PP TIGR00131 153 llriqkveehfvGvncGgmDqlasvlGeedhallvefrkLkatpvklpqleialviantnvksnlapseYnlRrqe 228 ++ +q+ e ++ GvncG+mDq+asv+G+ ++ +++r+L+++++++ + lv++++ vk++la+s Yn Rrq lcl|FitnessBrowser__Btheta:349898 152 AKVGQATEHNYCGVNCGIMDQFASVFGKAGSLIRLDCRSLEYQYFPFHPEGYRLVLMDSVVKHELASSAYNKRRQS 227 9999*******************************************999************************** PP TIGR00131 229 veeaakvlakks.ekgaLrDvkeeefaryearltkllqlvekqRakhvvsenlRvlkavkllkdedlkelGkLmne 303 +e a+ +++kk + LrD + + + ++ + Ra +v+ e +Rvl+ ++l+++d +++G+ m e lcl|FitnessBrowser__Btheta:349898 228 CEAAVAAIQKKHpHVEFLRDCTMDMLE---EAKADINAEDYM-RAEYVIEEIQRVLDVCDALEKDDYETVGQKMYE 299 ********9995155679999998888...666677776665.********************************* PP TIGR00131 304 sqasldddyeitvpeidelvesialvnGsiGsRltGaGfGGCtvalvpnenvekvrkalaekYekktdlklefavi 379 + + ++ye+++ e+d + a+ G++GsR+ G+GfGGCt++lv+ne +++ ++ e +++k + + + + lcl|FitnessBrowser__Btheta:349898 300 THHGMSKLYEVSCEELD-FLNDCAKEYGVTGSRVMGGGFGGCTINLVKNELYDNFVEKTKEAFKAKFGRSPKVYDV 374 *****************.88999999***************************************99999999988 PP TIGR00131 380 vskealge 387 v++++ ++ lcl|FitnessBrowser__Btheta:349898 375 VIGDGSRK 382 88888775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (388 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.83 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory