Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate 350543 BT1015 putative oxidoreductase (NCBI ptt file)
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >FitnessBrowser__Btheta:350543 Length = 295 Score = 133 bits (334), Expect = 5e-36 Identities = 84/268 (31%), Positives = 138/268 (51%), Gaps = 18/268 (6%) Query: 2 SSPANANVRLADSAFARYPSLVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAG 61 ++ + +A ++ SL R + +TGGA GIG + VE F G +VAF DI+A +G Sbjct: 32 TTSSQVKTEVAGEIVSKSDSLKKR-IFVTGGAEGIGRAIVEAFCKDGHQVAFCDINAVSG 90 Query: 62 EALADELGDSKHKPLFLSCDLTDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVT 121 + A + G +F D++D +AL+ + + I +++NN K +I E + Sbjct: 91 QQTARDTG-----AIFHPVDVSDKEALESCMQQILDEWKDIDIVINNVGISKFSSITETS 145 Query: 122 RESFDAGIAVNIRHQFFAAQAVMEDMKAANS----GSIINLGSISWMLKNGGYPVYVMSK 177 E FD ++VN+R F ++ + KA + G IIN+ S +++ G Y SK Sbjct: 146 VEDFDKILSVNLRPVFITSRLLAIHRKAQSDSNPYGRIINICSTRYLMSEPGSEGYAASK 205 Query: 178 SAVQGLTRGLARDLGHFNIRVNTLVPGWVMTEKQKRLWLDDAGRR-SIKEGQCIDAELEP 236 + LT LA L +NI VN++ PGW+ T+ +L +D + S + G +P Sbjct: 206 GGIYSLTHALALSLSEWNITVNSIAPGWIQTQNYDQLRPEDHSQHPSRRVG-------KP 258 Query: 237 ADLARMALFLAADDSRMITAQDIVVDGG 264 D+ARM LFL D++ I ++I +DGG Sbjct: 259 EDIARMCLFLCRDENDFINGENITIDGG 286 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 295 Length adjustment: 26 Effective length of query: 240 Effective length of database: 269 Effective search space: 64560 Effective search space used: 64560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory