GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pgmA in Bacteroides thetaiotaomicron VPI-5482

Align Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 (characterized)
to candidate 351076 BT1548 phosphoglucomutase phosphomannomutase (NCBI ptt file)

Query= SwissProt::P18159
         (581 letters)



>lcl|FitnessBrowser__Btheta:351076 BT1548 phosphoglucomutase
           phosphomannomutase (NCBI ptt file)
          Length = 581

 Score =  466 bits (1198), Expect = e-135
 Identities = 251/553 (45%), Positives = 366/553 (66%), Gaps = 23/553 (4%)

Query: 8   ERWKQTEHLDLELK---ERLIELEGDEQALEDCFYKDLEFGTGGMRGEIGAGTNRMNIYT 64
           E+W  T   D E +   +R++E E D+  L + FYKDLEFGTGG+RG +G G+NRMNIYT
Sbjct: 15  EKWL-TPAYDAETQAEVKRMLENE-DKTELIEAFYKDLEFGTGGLRGIMGVGSNRMNIYT 72

Query: 65  VRKASAGFAAYISKQGEEAKKRGVVIAYDSRHKSPEFAMEAAKTLATQGIQTYVFDELRP 124
           V  A+ G + Y+ K  ++  +  VV+ +D R+ S  FA  +A   +  GI+ Y+FD++RP
Sbjct: 73  VGAATQGLSNYLKKNFKDLPQISVVVGHDCRNNSRLFAETSANIFSANGIKVYLFDDMRP 132

Query: 125 TPELSFAVRQLNAYGGIVVTASHNPPEYNGYKVYGDDGGQ-LPPKEADIVIEQVNAIENE 183
           TPE+SFA+R L    GI++TASHNP EYNGYK Y DDG Q L P +A I I++VN I + 
Sbjct: 133 TPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDAGI-IDEVNNIASA 191

Query: 184 LTITVDEENKLKEKG---LIKIIGEDIDKVYTEKLTSISVHPE-LSEEVDVKVVFTPLHG 239
             I        K KG   LI+IIGEDIDK+Y + + ++S+ PE ++   D+K+V+TP+HG
Sbjct: 192 ADI--------KFKGNPDLIQIIGEDIDKIYLDMVKTVSIDPEAIARHKDMKIVYTPIHG 243

Query: 240 TANKPVRRGLEALGYKNVTVVKEQELPDSNFSTVTSPNPEEHAAFEYAIKLGEEQNADIL 299
           T    + R L+  G++NV  V EQ + D NF TV SPNPE   A   A+ L +E +AD++
Sbjct: 244 TGMMLIPRALKMWGFENVFTVPEQMIKDGNFPTVISPNPENAEALSMAVNLAKEIDADLV 303

Query: 300 IATDPDADRLGIAVKNDQGKYTVLTGNQTGALLLHYLLSEKKKQGILPDNGVVLKTIVTS 359
           +A+DPDADR+GIA K+D+G++ ++ GNQT  + L+Y+L++ K+ G +  N   +KTIVT+
Sbjct: 304 MASDPDADRVGIACKDDKGEWVLINGNQTCMMYLYYILTQYKQLGKIKGNEFCVKTIVTT 363

Query: 360 EIGRAVASSFGLDTIDTLTGFKFIGEKIKEYEASGQYTFQFGYEESYGYLIGDFARDKDA 419
           E+ + +A    ++ +D  TGFK+I  +I+  E   +Y    G EESYG+L  DF RDKDA
Sbjct: 364 ELIKKIADKNNIEMLDCYTGFKWIAREIRLREGKKKYI--GGGEESYGFLAEDFVRDKDA 421

Query: 420 IQAALLAVEVCAFYKKQGMSLYEALINLFNEYGFYREGLKSLTLKGKQGAEQIEAILASF 479
           + A  L  EV A+ K  G SLY+ L++++ EYGF +E   ++   GK GAE+I+A++ +F
Sbjct: 422 VSACCLIAEVAAWAKDNGKSLYQLLLDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMENF 481

Query: 480 RQNPPQKMAGKQVVTAEDYAVSKRTLLTESKEEAIDLPK-SNVLKYFLEDGSWFCLRPSG 538
           R NPP+++ G +V+ ++DY   K+T   E K   +D+P+ SNVL+YF EDGS   +RPSG
Sbjct: 482 RANPPKELGGSKVILSKDYKTLKQT-DAEGKVTDLDMPETSNVLQYFTEDGSKVSVRPSG 540

Query: 539 TEPKVKFYFAVKG 551
           TEPK+KFY  V+G
Sbjct: 541 TEPKIKFYMEVQG 553


Lambda     K      H
   0.313    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 835
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 581
Length of database: 581
Length adjustment: 36
Effective length of query: 545
Effective length of database: 545
Effective search space:   297025
Effective search space used:   297025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory