Align isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate 351334 BT1806 acyl-CoA dehydrogenase (NCBI ptt file)
Query= BRENDA::Q75N94 (430 letters) >FitnessBrowser__Btheta:351334 Length = 568 Score = 147 bits (371), Expect = 8e-40 Identities = 125/423 (29%), Positives = 206/423 (48%), Gaps = 45/423 (10%) Query: 32 RTFASKHPKGFVPPTEDELLELRERVQEFTRREITEEV----AAKTDAQNEFPA------ 81 R + K + P ++ L+ ++V E T EIT E+ A D + A Sbjct: 29 RNYRDKDEFDYAPLDFEDALDSYDKVLEITG-EITGEIINANAEGVDEEGPHCANGRVEY 87 Query: 82 -----EMWKKLGDAGFLGITANEDYGGLGMGYQAHCIVMEELSRASGSIALSYAAHSQLC 136 E + AG G+T +GGL + + E ++ A ++ Q C Sbjct: 88 ASGTKENLDAMVKAGLNGMTMPRRFGGLNFPITPYTMCAEIVAAADAGFGNIWSL--QDC 145 Query: 137 VNQLSLNGSPEQKERFLPGLLSGDKIGALAMSEHSAGSDV--VSMKTTAKEVDGGYVLNG 194 + L G+ +Q RF+P + G+ + ++ ++E AGSD+ V +K T E DG ++LNG Sbjct: 146 IETLYEFGNADQHSRFIPRVCQGETM-SMDLTEPDAGSDLQAVMLKATYSEKDGCWLLNG 204 Query: 195 TKMWITNGPDADFIVVYAKTEP-QKGSKGITAFVVEKTFDGFSCARKLDKLGMRGSNTGE 253 K +ITNG DAD +V A++E + +G++ F+ +K G R KLG+ GS T E Sbjct: 205 VKRFITNG-DADIHLVLARSEEGTRDGRGLSMFIYDKRQGGVDVRRIEHKLGIHGSPTCE 263 Query: 254 LIFEDVFVPKENVLGEVNRG-VKVLMEGLDLERLVLSAGPLGIMQAALDLVLPYTHVRKQ 312 L++++ K + G+ G +K +M ++ RL ++A +G+ QAA + L Y RKQ Sbjct: 264 LVYKNA---KAELCGDRKLGLIKYVMALMNGARLGIAAQSVGLSQAAYNEGLAYAKDRKQ 320 Query: 313 FGTPIAHNQLIQGKLADMYTKLQASRAYTYSTARHIDNSASLSEVS----IRTQDCAGAI 368 FG I + LA M KL A RA Y TAR++D +L ++S + ++ Sbjct: 321 FGKAIIDFPAVYDMLAIMKGKLDAGRALLYQTARYVDIYKALDDISRERKLTPEERLEQK 380 Query: 369 LYA--------------AERATECALDAIQLMGGNGYINELPAGRLLRDAKLYEIGAGTS 414 YA +E A + A D IQ+ GG+G++ E R+ RDA++ I GT+ Sbjct: 381 KYAKLADSFTPLAKGMNSEYANQNAYDCIQIHGGSGFMMEYACQRIYRDARITSIYEGTT 440 Query: 415 EIR 417 +++ Sbjct: 441 QLQ 443 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 568 Length adjustment: 34 Effective length of query: 396 Effective length of database: 534 Effective search space: 211464 Effective search space used: 211464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory