Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate 351445 BT1917 propionyl-CoA carboxylase beta chain (NCBI ptt file)
Query= reanno::SB2B:6937191 (535 letters) >FitnessBrowser__Btheta:351445 Length = 511 Score = 251 bits (642), Expect = 4e-71 Identities = 173/505 (34%), Positives = 261/505 (51%), Gaps = 34/505 (6%) Query: 30 KDKLAHIEQGGGLVAMERHLSRGKLAPRARVEKLLDPGSPFLELSQFAAFEV--YDED-- 85 +D++A + GGG+ +E+ GK+ R R+E LLD G+ F+EL + Y D Sbjct: 14 RDRIASL--GGGVEKIEKQHESGKMTARERIEMLLDKGT-FVELDKLMVHRCTNYGMDKN 70 Query: 86 -VPAAGIIAGIGRVSGVECMIIANDATVKGGTYYPITVKKHLRAQAIAERCHLPCIYLVD 144 +P GI++G G++ G + + A D TV GG+ KK ++ Q +A + P I L D Sbjct: 71 KIPGDGIVSGYGKIDGRQVFVYAYDFTVYGGSLSASNAKKIVKVQQLALKNGAPIIALND 130 Query: 145 SGGANLPRQDEVFPDRDHFGRIFFNQARMSAKGIPQIAVVMGLCTAGGAYVPAMADESII 204 SGGA + E + IF+ Q M++ IPQI+ ++G C G Y PA+ D + Sbjct: 131 SGGARI---QEGIESLSGYADIFY-QNTMASGVIPQISAILGPCAGGACYSPALTDFIFM 186 Query: 205 VREQGTIFLAGPPLVKAATGEEVSAEELGGGDVHTKISGVADHLAQNDEHALELARKAVS 264 V+E+ +F+ GP +VK EEVS EELGG H+ SGV + +E L R+ +S Sbjct: 187 VKEKSHMFVTGPDVVKTVIHEEVSKEELGGAMTHSSKSGVTHFMCNTEEELLMSIRELLS 246 Query: 265 RL--NHQKQVELQLSKVKPPKYDINELYGIVGTDLKKPFDVKEVIARIVDDSDFDEFKAN 322 L N+ + + Q + + D L IV D P+D+K++I R+VD+ F E N Sbjct: 247 FLPQNNMDETKKQNCTDETNREDA-VLDTIVPADPNVPYDMKDIIERVVDNGYFFEVMTN 305 Query: 323 YGTTLVCGFARIHGYPVGIVANN-----GILFSESAQKGAHFIELCCQRKIPLVFLQNIT 377 + ++ GFAR+ G VGIVAN G+L +++ K + FI C IPL+ +++ Sbjct: 306 FAKNIIIGFARLAGRSVGIVANQPAYLAGVLDIDASDKASRFIRFCDCFNIPLITFEDVP 365 Query: 378 GFMVGKKYEHEGIAKHGAKMVTAVSCATVPKFTVLIGGSYGAGNYGMCGRAFEPTLMWMW 437 GF+ G E+ GI +HGAK+V A + ATVPK TV+ +YG M + + + + Sbjct: 366 GFLPGYTQENNGIIRHGAKIVYAFAEATVPKLTVITRKAYGGAYIVMNSKQTGADVNFAY 425 Query: 438 PNARISVMGGEQAAGVLATVRKDGLARKGETMSAEEEAKFKAPIIAQYDKEGHPYHASAR 497 P+A I+VMG E A +L RK KG+ + A +E K PY A+ Sbjct: 426 PSAEIAVMGAEGAVNIL--FRKADAETKGKELEAYKE------------KFATPYQAAEL 471 Query: 498 LWDDGIIDPAQTRDVLGLAISAALN 522 + D II P QTR L A+ N Sbjct: 472 GFIDEIIYPRQTRKRLIQALEMTEN 496 Lambda K H 0.320 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 664 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 535 Length of database: 511 Length adjustment: 35 Effective length of query: 500 Effective length of database: 476 Effective search space: 238000 Effective search space used: 238000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory