Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate 353284 BT3758 acetylornithine aminotransferase (NCBI ptt file)
Query= reanno::Putida:PP_4108 (416 letters) >FitnessBrowser__Btheta:353284 Length = 373 Score = 167 bits (424), Expect = 4e-46 Identities = 126/400 (31%), Positives = 193/400 (48%), Gaps = 49/400 (12%) Query: 13 VHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAA 72 ++ I + G+ +VWD +G Y+D GG V+++GH +P VE I Q L Y+ N+ Sbjct: 9 LYDINIVKGQGCKVWDENGTEYLDLYGGHAVISIGHAHPHYVEMISNQVATLGFYS-NSV 67 Query: 73 PHGPYLALMEQLSQFVPVS-YPLAGMLTNSGAEAAENALKVARGATGKRAIIAFDGGFHG 131 + + E+L + Y L L NSGAEA ENALK+A G+ +I+F FHG Sbjct: 68 INKLQQQVAERLGKISGYEDYSL--FLINSGAEANENALKLASFYNGRTKVISFSKAFHG 125 Query: 132 RTLATLNLNGK---VAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAV 188 RT + +AP G V +LP ++AM + ELA Sbjct: 126 RTSLAVEATNNPTIIAPINNN-----GHVTYLPLND----------IEAMKQ----ELAK 166 Query: 189 EDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRL 248 DV A I E +QG GG F Q LR+ C E G ++I+DEIQSG+GR+G+ FA Sbjct: 167 GDVCAVIIEGIQGVGGIKIPTTEFMQELRKVCTETGTILILDEIQSGYGRSGKFFAHQYN 226 Query: 249 GIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPK---GGLGGTYSGNPISCAAALASLAQ 305 I+PD++ +AK I G P+ V L++ + K G LG T+ GN ++C+AALA + Sbjct: 227 HIQPDIITVAKGIGNGFPMAGV-----LISPMFKPVYGQLGTTFGGNHLACSAALAVMDV 281 Query: 306 MTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQLA 365 + +NL + ++ +++ P I + G G M G+EF + Sbjct: 282 IEQDNLVENAKAVGDYLLEELKKF------PQIKEVRGRGLMIGLEF---------EEPI 326 Query: 366 KVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGL 405 K + + + +++RLL PL + E +E L Sbjct: 327 KELRSRLIYDEHVFTGASGTNVLRLLPPLCLSMEEADEFL 366 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 373 Length adjustment: 31 Effective length of query: 385 Effective length of database: 342 Effective search space: 131670 Effective search space used: 131670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory