Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate 350994 BT1466 ABC transporter ATP-binding protein (NCBI ptt file)
Query= BRENDA::P68187 (371 letters) >FitnessBrowser__Btheta:350994 Length = 238 Score = 135 bits (341), Expect = 9e-37 Identities = 83/208 (39%), Positives = 123/208 (59%), Gaps = 10/208 (4%) Query: 21 DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK---RMND---TPPAE 74 ++ L + +GEFV +GPSGCGKSTLL ++ L++ TSG F K +MN+ T + Sbjct: 23 EVTLHVEQGEFVAIMGPSGCGKSTLLNILGTLDSPTSGSYFFEGKQVDKMNENQLTALRK 82 Query: 75 RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKAL 134 +G +FQS+ L L+V EN+ L G K ++VN+V E + L H + P+ L Sbjct: 83 NNLGFIFQSFNLIDELTVYENVELPLVYMGIKTAQRKEKVNKVLEKVNLLHRANHYPQQL 142 Query: 135 SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQ 194 SGGQ+QRVAI R +V + + L DEP NLD+ V++ +S L+ R G T+I VTH Q Sbjct: 143 SGGQQQRVAIARAVVTDCKLLLADEPTGNLDSVNGVEVMELLSELN-RQGTTIIIVTHSQ 201 Query: 195 VEAMTLADKIVVLDAGRVA--QVGKPLE 220 +A T A +I+ L G++ + +PLE Sbjct: 202 RDA-TYAHRIIRLLDGQIVSENINRPLE 228 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 238 Length adjustment: 26 Effective length of query: 345 Effective length of database: 212 Effective search space: 73140 Effective search space used: 73140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory