Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate 350819 BT1291 spermidine/putrescine transport ATP-binding protein (NCBI ptt file)
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Btheta:350819 Length = 463 Score = 216 bits (551), Expect = 8e-61 Identities = 113/274 (41%), Positives = 163/274 (59%), Gaps = 6/274 (2%) Query: 26 LEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIAMVFQN 85 L + GEF+ ++GPSGCGK+T LR++AG + ++G I I K++T P R + VFQ Sbjct: 30 LNVKKGEFVTILGPSGCGKTTLLRLIAGFQTASEGEIRISGKEITQTPPHKRPVNTVFQK 89 Query: 86 YALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQRQRVA 145 YAL+PH+ V +N+ F LK+ + I K+V A +G+T++ R +LSGGQ+QRVA Sbjct: 90 YALFPHLNVYDNIAFGLKLKKTPKQTIGKKVKAALKMVGMTDYEYRDVDSLSGGQQQRVA 149 Query: 146 MGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEALTMGDR 205 + RAIV P+V L+DEPL+ LD K+R + ++ + + LG+T VYVTHDQ EALT+ D Sbjct: 150 IARAIVNEPEVLLLDEPLAALDLKMRKDMQMELKEMHKSLGITFVYVTHDQEEALTLSDT 209 Query: 206 IAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATSGHARIKLSPE 265 I V+ +G +QQ+G P ++Y+ P N FVA FIG + GT + D + E Sbjct: 210 IVVMSEGKIQQIGTPIDIYNEPINSFVADFIGESNILNGTM-IHDKLVRFCGTEFECVDE 268 Query: 266 TLAAMTPEDNGRITIGFRPEALEIIPEGESTDLS 299 TP D + RPE L I P E L+ Sbjct: 269 GFGENTPVD-----VVIRPEDLYIFPVSEMAQLT 297 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 463 Length adjustment: 31 Effective length of query: 345 Effective length of database: 432 Effective search space: 149040 Effective search space used: 149040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory