Align beta-Phosphoglucomutase (EC 5.4.2.6) (characterized)
to candidate 350225 BT0697 putative phosphatase/phosphohexomutase (NCBI ptt file)
Query= BRENDA::P71447 (221 letters) >FitnessBrowser__Btheta:350225 Length = 215 Score = 64.7 bits (156), Expect = 1e-15 Identities = 65/222 (29%), Positives = 90/222 (40%), Gaps = 32/222 (14%) Query: 4 AVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKIL-DLADK 62 A LFD DGVI DT + W + +N D F ++KG + +K DL + Sbjct: 8 AALFDFDGVIMDTETQYTVFWDEQGRKY-LNEED--FGRRIKGQTLTQIYEKYFSDLPE- 63 Query: 63 KVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFL 122 A+++ + + + + PG+ + DLR + KIA+ ++S Sbjct: 64 ----------AQQEITAGLNIYEKSMSYEYIPGVEAFIADLRKHGAKIAVVTSSNE---- 109 Query: 123 LEKMN--------LTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAG 174 EKM G D I A SKPAPD F+ G P S EDS G Sbjct: 110 -EKMQNVYNAHPEFKGMVDRILTGEMFARSKPAPDCFLLGMEIFGATPENSYVFEDSFHG 168 Query: 175 IQAIKDSGALPIGVG----RPEDLGDDIVIVPDTSYYTLEFL 212 +QA SGA IG+ R G I+ D S T E L Sbjct: 169 LQAGMTSGATVIGLATTNTREAITGKAHYIIDDFSEMTFEHL 210 Lambda K H 0.316 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 221 Length of database: 215 Length adjustment: 22 Effective length of query: 199 Effective length of database: 193 Effective search space: 38407 Effective search space used: 38407 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory