Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 351279 BT1751 Glycine betaine transport ATP-binding protein (NCBI ptt file)
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Btheta:351279 Length = 408 Score = 137 bits (346), Expect = 3e-37 Identities = 91/255 (35%), Positives = 143/255 (56%), Gaps = 18/255 (7%) Query: 2 MELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRN 61 +++L K E + G AV + +N+GE I+G SGSGKS +LLR INR Sbjct: 21 LKMLKEGKTKSEILKATGCTVAVKDANLSINEGEIFVIMGLSGSGKS----TLLRCINRL 76 Query: 62 GRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQN----PMTSLNPIIRVGIQVMEPI 117 R GE I G D+ K++ +EL IR K+++++FQN P S+ I G+++ Sbjct: 77 IRPTSGEVIINGTDIAKVSDKELLQIRRKELAMVFQNFGLLPHRSVLHNIAFGLELQG-- 134 Query: 118 IWHRLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLI 177 +K E ++A+E ++ VG+ + ++ + SGGM+QRV +A ALA +P++L+ Sbjct: 135 -----VKKGEREQKAMESMQLVGLKGYENQMVS---ELSGGMQQRVGLARALANNPEVLL 186 Query: 178 ADEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEA 237 DE +ALD I+ Q+ + L L+ + +++FITHDLS A DRI M G+IV+ Sbjct: 187 MDEAFSALDPLIRVQMQDELLTLQSKMKKTIVFITHDLSEAIKLGDRIAIMKDGEIVQIG 246 Query: 238 PVEEILKTPLHPYTK 252 EEIL P + Y + Sbjct: 247 TSEEILTEPANAYVE 261 Score = 25.0 bits (53), Expect = 0.003 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 4/28 (14%) Query: 64 IVDGEAIFLGK----DLLKLNKEELRNI 87 +VD + +G+ DLLKL KE++R+I Sbjct: 310 VVDSNNLLVGEVRLNDLLKLRKEQIRSI 337 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 324 Length of database: 408 Length adjustment: 29 Effective length of query: 295 Effective length of database: 379 Effective search space: 111805 Effective search space used: 111805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory