Align Phosphoglucosamine/phosphogalactosamine mutase; PGlcNM; EC 5.4.2.10; EC 5.4.2.13 (characterized)
to candidate 353476 BT3950 phosphoglucomutase/phosphomannomutase (NCBI ptt file)
Query= SwissProt::Q976E4 (455 letters) >FitnessBrowser__Btheta:353476 Length = 462 Score = 216 bits (549), Expect = 2e-60 Identities = 152/471 (32%), Positives = 235/471 (49%), Gaps = 46/471 (9%) Query: 9 GVRGIVN----KELTPELVLKLSKAIGTFFGK-----NSKILVGRDVRAGGDMLVKIVEG 59 G+RG + + L P ++K + A T K ++KI+VGRD R G+M+ +V G Sbjct: 9 GIRGTIGGGAGEGLNPLDIVKFTSAYATLIRKTCKAQSNKIVVGRDARISGEMVKNVVVG 68 Query: 60 GLLSVGVEVYDGGMAPTPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDKDGIEIRRE 119 L+ +G +V D +A TP + AV G GG+++TASHNP +N +K++++ G + E Sbjct: 69 TLMGMGWDVVDIDLASTPTTELAVTMEGACGGIILTASHNPKQWNALKLLNEHGEFLNAE 128 Query: 120 KENEIEDLFFTERFNTIEWS-------SLTTEVKREDRVISTYVNGILSHVDIEKIKKKN 172 + NE+ + E F+ + LT K D V++ L VD+E IKK N Sbjct: 129 EGNEVLRIAEAEEFDYADVDHLGSYRKDLTYNQKHIDSVLA------LDLVDVEAIKKAN 182 Query: 173 YKVLIDPANSVGALSTPLVARALGCKIYTINGNLDPLFSA------RQPEPTFDSLKETA 226 ++V ID NSVG + P + LG K +++ L+ PEP +L + Sbjct: 183 FRVAIDCVNSVGGIILPELLERLGVK------HVEKLYCEPTGNFQHNPEPLEKNLGDIM 236 Query: 227 EVVKTLKVDLGVAHDGDADRAIFIDSEGRVQWGDRSGTLLSYWASVKNPKAIKKIVTAVS 286 ++K K D+ D D DR I G V +G+ + +K+ V+ +S Sbjct: 237 NLMKGGKADVAFVVDPDVDRLAMICENG-VMYGEEYTLVTVADYVLKHTPG--NTVSNLS 293 Query: 287 SSSLVEEYLSKYNIQVDWTKVGSVDIAHKVADENALAGFEENGGFMYPPHQYVRDGAMSF 346 S+ + + KY ++ + VG V++ K+ NA+ G E NGG +YP Y RD + Sbjct: 294 STRALRDVTRKYGMEYSASAVGEVNVVTKMKATNAVIGGEGNGGVIYPASHYGRDALVGI 353 Query: 347 ALMLELLANENVSSAELFDRLPKYYLVKTKVDLKPGLMVEEIYKKILEVYSTSSVKAITI 406 AL L LA+E +EL P Y++ K +VDL P + V+ I K+ E+Y + I Sbjct: 354 ALFLSHLAHEGKKVSELRATYPPYFIAKNRVDLIPEIDVDAILAKVKEIYKNEEIN--DI 411 Query: 407 DGVKIIGKDFWFLVRKSGTEPIIRIMAEAKDENVAN-------NLVNELKK 450 DGVKI D W +RKS TEPIIR+ +EA A +++NEL K Sbjct: 412 DGVKIDFADKWVHLRKSNTEPIIRVYSEASTMGAAEEIGQKIMDVINELAK 462 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 462 Length adjustment: 33 Effective length of query: 422 Effective length of database: 429 Effective search space: 181038 Effective search space used: 181038 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory