Align Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate 353455 BT3929 triosephosphate isomerase (NCBI ptt file)
Query= SwissProt::P29613 (247 letters) >lcl|FitnessBrowser__Btheta:353455 BT3929 triosephosphate isomerase (NCBI ptt file) Length = 252 Score = 224 bits (572), Expect = 1e-63 Identities = 122/248 (49%), Positives = 166/248 (66%), Gaps = 5/248 (2%) Query: 3 RKFCVGGNWKMNGDQKSIAEIAKTLSSAALD--PNTEVVIGCPAIYLMYARNLLPC-ELG 59 RK V GNWKMN + +AK L+ A + PN +V+I P I+L L+ ++G Sbjct: 2 RKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKIG 61 Query: 60 LAGQNAYKVAKGAFTGEISPAMLKDIGADWVILGHSERRAIFGESDALIAEKAEHALAEG 119 + +N A GA+TGE+S M+ GA +VILGHSERRA +GE+ A++ EK + ALA G Sbjct: 62 VGAENCADKASGAYTGEVSAEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANG 121 Query: 120 LKVIACIGETLEEREAGKTNEVVARQM-CAYAQKIKDWKNVVVAYEPVWAIGTGQTATPD 178 L I CIGE LEEREA K NEVVA QM ++ +D+ +++AYEPVWAIGTG+TA+P+ Sbjct: 122 LTPIFCIGEVLEEREANKQNEVVAAQMESVFSLSAEDFSKIILAYEPVWAIGTGKTASPE 181 Query: 179 QAQEVHAFLRQWLSDNISKEVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLK-P 237 QAQE+HAF+R ++D KE++ + I YGGS +NAKEL PD+DG L+GGA+LK Sbjct: 182 QAQEIHAFIRSIVADKYGKEIADNTSILYGGSCKPSNAKELFSNPDVDGGLIGGAALKVS 241 Query: 238 EFVDIINA 245 +F II+A Sbjct: 242 DFKGIIDA 249 Lambda K H 0.316 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 252 Length adjustment: 24 Effective length of query: 223 Effective length of database: 228 Effective search space: 50844 Effective search space used: 50844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate 353455 BT3929 (triosephosphate isomerase (NCBI ptt file))
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.14932.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-66 210.9 2.2 1.3e-66 210.7 2.2 1.0 1 lcl|FitnessBrowser__Btheta:353455 BT3929 triosephosphate isomerase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353455 BT3929 triosephosphate isomerase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 210.7 2.2 1.3e-66 1.3e-66 1 226 [. 5 239 .. 5 241 .. 0.96 Alignments for each domain: == domain 1 score: 210.7 bits; conditional E-value: 1.3e-66 TIGR00419 1 lviinfKlnesvgkvelevaklaeevasea.gvevavappfvdldvvkdeve.seiqvaAqnvdavksGaftGeis 74 +v +n+K+n ++++ + +l+e +a+e+ ++ v + pf++l v+ v+ ++i v+A n+ + sGa+tGe+s lcl|FitnessBrowser__Btheta:353455 5 IVAGNWKMNKTLQEGIALAKELNEALANEKpNCDVIICTPFIHLASVTPLVDaAKIGVGAENCADKASGAYTGEVS 80 699***********************987548******************99899********************* PP TIGR00419 75 AemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaaaA.... 146 Aem++ +Gak+v++gHsErR++ e+ ++e+kv + + gl+++ C+ge leerea ++ ++va + + + lcl|FitnessBrowser__Btheta:353455 81 AEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQMESVFslsa 156 ****************************************************************999887766777 PP TIGR00419 147 ..lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGasvtaaedaelaaqldvdGvL 219 +++ ++A+EPv++iGtGk++s+ +a+++++++r ++ ke+a+++++lyG+s + ++++el+ ++dvdG L lcl|FitnessBrowser__Btheta:353455 157 edFSKIILAYEPVWAIGTGKTASPEQAQEIHAFIRSIVADkYGKEIADNTSILYGGSCKPSNAKELFSNPDVDGGL 232 88*********************************99987799********************************* PP TIGR00419 220 lasavlk 226 +++a lk lcl|FitnessBrowser__Btheta:353455 233 IGGAALK 239 *****99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (252 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.98 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory