Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate 354228 BT4702 dihydroxynapthoic acid synthetase (NCBI ptt file)
Query= SwissProt::Q0AVM1 (260 letters) >FitnessBrowser__Btheta:354228 Length = 274 Score = 146 bits (369), Expect = 4e-40 Identities = 101/269 (37%), Positives = 148/269 (55%), Gaps = 28/269 (10%) Query: 3 YENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSF 62 YE+I+ + +A + INR + NA T E+ DA+ ++ +++++ITG+GDK+F Sbjct: 13 YEDILFDYYNGIARITINRERYRNAFTPTTTAEMSDALRICREEADIDVIVITGAGDKAF 72 Query: 63 VAGADIAFMQNLSAMEAREFGALGQK---------VFRLIEAMEKPVIAAVNGFALGGGC 113 +G D QN+ G +G+ V + I ++ KPVIAAVNGFA+GGG Sbjct: 73 CSGGD----QNVKGRG----GYIGKDGVPRLSVLDVQKQIRSIPKPVIAAVNGFAIGGGH 124 Query: 114 ELAMCCDFRIAASNAKFGQ--PEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINAD 171 L + CD IA+ NA FGQ P VG GFG + L R+VG A+++ + NA Sbjct: 125 VLHVVCDLSIASENAIFGQTGPRVG-SFDAGFGASY-LARVVGQKKAREIWFLCRKYNAQ 182 Query: 172 EAFRIGLVNKVVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIE-- 229 EA +GLVNKVV E+L E + A ++ LA+R+ KA G+ ++D I+ Sbjct: 183 EALDMGLVNKVVPLEQLEDEYVQWAEEMMLLSPLALRMIKA----GLNAELDGQAGIQEL 238 Query: 230 -ADAFGLCFATQDQKEGMTAFLEKRKANF 257 DA L + T + +EG AFLEKRK NF Sbjct: 239 AGDATLLYYLTDEAQEGKNAFLEKRKPNF 267 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 274 Length adjustment: 25 Effective length of query: 235 Effective length of database: 249 Effective search space: 58515 Effective search space used: 58515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory