Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate 350849 BT1321 putative phosphate transport ATP-binding protein (NCBI ptt file)
Query= uniprot:A0A159ZWS6 (255 letters) >FitnessBrowser__Btheta:350849 Length = 252 Score = 89.7 bits (221), Expect = 5e-23 Identities = 74/248 (29%), Positives = 124/248 (50%), Gaps = 21/248 (8%) Query: 6 LKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTT---VFNCLTGFYQPTG--G 60 + +++ +G A+ G+++ ++EK VVA IGP+G GK+T +FN + T G Sbjct: 6 IDTRDVNFWYGDFHALKGISMQIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPATRLEG 65 Query: 61 TILLDGEPI--QGLPGHHIARKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGLF 118 I +DG I +G+ + RK V FQ F + EN+ L N G+ Sbjct: 66 EIRIDGHNIYAKGVEVDEL-RKNVGMVFQRPNPFPK-SIFENVAYG----LRVN---GVK 116 Query: 119 KTPAFRKSEREAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLD 178 R+ E ++ A W D+V + A L+ GQQ+RL IAR M P +L++D Sbjct: 117 DNAFIRQRVEETLKGAALW-DEVK--DKLKESAYALSGGQQQRLCIARAMAVSPSVLLMD 173 Query: 179 EPAAGLNPKETEDLKALIGVLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTP 238 EPA+ L+P T ++ LI L++++ T++++ H+M+ +SD G + Sbjct: 174 EPASALDPISTAKVEELIHELKKDY--TIVIVTHNMQQAARVSDKTAFFYLGEMVEYDDT 231 Query: 239 EQIRDNPE 246 ++I NPE Sbjct: 232 KKIFTNPE 239 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory