Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate 353284 BT3758 acetylornithine aminotransferase (NCBI ptt file)
Query= BRENDA::Q9I6M4 (426 letters) >FitnessBrowser__Btheta:353284 Length = 373 Score = 199 bits (506), Expect = 1e-55 Identities = 134/392 (34%), Positives = 207/392 (52%), Gaps = 45/392 (11%) Query: 30 RAENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIE 89 + + VWD G EY+D GG AV++ GH HP + + Q+ L V+ + Sbjct: 16 KGQGCKVWDENGTEYLDLYGGHAVISIGHAHPHYVEMISNQVATLGFYSNSVIN-----K 70 Query: 90 LAEEIAKR---VPGDFPKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMT 146 L +++A+R + G L+ SG+EA ENA+K+A GR VI+F+ A+HGRT + Sbjct: 71 LQQQVAERLGKISGYEDYSLFLINSGAEANENALKLASFYNGRTKVISFSKAFHGRTSLA 130 Query: 147 LGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIII 206 + T +AP +G + IE + K + D+ A+II Sbjct: 131 VEATNNPT---------------IIAPINNNGHVTYLPLNDIEAM-KQELAKGDVCAVII 174 Query: 207 EPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTT 266 E +QG GG + + FMQ LR +C + G +LI DE+Q+G GR+G FFA + I PD+ T Sbjct: 175 EGIQGVGGIKIPTTEFMQELRKVCTETGTILILDEIQSGYGRSGKFFAHQYNHIQPDIIT 234 Query: 267 FAKSVGGGFPISGVAGKAEIMDAIAP--GGLGGTYAGSPIACAAALAVLKVFEEEKLLER 324 AK +G GFP++GV I P G LG T+ G+ +AC+AALAV+ V E++ L+E Sbjct: 235 VAKGIGNGFPMAGVL----ISPMFKPVYGQLGTTFGGNHLACSAALAVMDVIEQDNLVEN 290 Query: 325 SQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREK 384 ++AVG+ L L+ K I +VRG G M+ +E E P EL S+++ ++ Sbjct: 291 AKAVGDYLLEELK----KFPQIKEVRGRGLMIGLEFEE------PIKELRSRLIY---DE 337 Query: 385 GLILLSCGTYYNVIRFLMPVTIPDAQLEKGLA 416 + + GT NV+R L P+ + + ++ LA Sbjct: 338 HVFTGASGT--NVLRLLPPLCLSMEEADEFLA 367 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 373 Length adjustment: 31 Effective length of query: 395 Effective length of database: 342 Effective search space: 135090 Effective search space used: 135090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory