Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 351278 BT1750 glycine betaine/L-proline transport system permease (NCBI ptt file)
Query= TCDB::Q9KKE2 (285 letters) >FitnessBrowser__Btheta:351278 Length = 276 Score = 246 bits (628), Expect = 4e-70 Identities = 134/271 (49%), Positives = 182/271 (67%), Gaps = 1/271 (0%) Query: 8 LSIRAPVNDFIQALVTNYGWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALACRSS 67 ++I + I L ++ F A+S I + + +L G+P+++ I ALA S Sbjct: 2 INIGQYIETAINWLTEHFASFFDALSMGIGGFIDGFQHVLFGIPFYITIAVLAALAWFKS 61 Query: 68 RRWSLTLAVCALLETVGVLGIWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNIT 127 + + + LL G +G W+ TMQTLAL+L +T +++++GVP+GI A S I Sbjct: 62 GKGTAVFTLLGLLLIYG-MGFWEETMQTLALVLSSTCLALLLGVPLGIWTANSDRCNKIM 120 Query: 128 LPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEA 187 PVLD MQTMP+FVYLIPA++ FGLG VP ATII+A+PP++RLT LGIRQV VVEA Sbjct: 121 RPVLDFMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180 Query: 188 ATAFGGSPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQT 247 + +FG +P Q+L+ V+LPLA PTI+ G+NQTIMM+LSMVV+A+MI A GLGE VL GI Sbjct: 181 SRSFGATPWQLLYKVQLPLALPTILTGINQTIMMSLSMVVIAAMISAGGLGEIVLKGITQ 240 Query: 248 LDVGKGLEAGIGIVILAVVLDRITQGFGKPR 278 + +G G E GI +VILA+VLDRITQG R Sbjct: 241 MKIGLGFEGGIAVVILAIVLDRITQGMADNR 271 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 276 Length adjustment: 26 Effective length of query: 259 Effective length of database: 250 Effective search space: 64750 Effective search space used: 64750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory