Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate 350742 BT1214 putative ABC transporter ATP-binding protein (NCBI ptt file)
Query= CharProtDB::CH_001555 (400 letters) >FitnessBrowser__Btheta:350742 Length = 247 Score = 130 bits (326), Expect = 5e-35 Identities = 79/205 (38%), Positives = 119/205 (58%), Gaps = 7/205 (3%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 ++ S I EGE IMG SGSGKST++ L L PT G+ L+D + + +S + + Sbjct: 24 LRGVSFTINEGEFVTIMGTSGSGKSTLLNTLGCLDTPTSGEYLLDDISVRTMSKPQRAVL 83 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFG-MELAGINAEERREKALDALRQVGLENYAHSYP 162 R +KI VFQS+ L+P T ++N M + ++A ERR +A++AL+ VGL + Sbjct: 84 RNRKIGFVFQSYNLLPKTTAVENVELPLMYNSSVSASERRRRAIEALQAVGLGDRLEHKS 143 Query: 163 DELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQ--RTIVF 220 +++SGG QRV +ARAL NP ++L DEA LD RT D LV Q H RTI+F Sbjct: 144 NQMSGGQMQRVAIARALVNNPAVILADEATGNLD--TRTSF-DILVLFQKLHAEGRTIIF 200 Query: 221 ISHDLDEAMRIGDRIAIMQNGEVVQ 245 ++H+ E + R +++G V++ Sbjct: 201 VTHN-PEIAQYSSRNIRLRDGHVIE 224 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 247 Length adjustment: 27 Effective length of query: 373 Effective length of database: 220 Effective search space: 82060 Effective search space used: 82060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory