Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate 351278 BT1750 glycine betaine/L-proline transport system permease (NCBI ptt file)
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__Btheta:351278 Length = 276 Score = 295 bits (756), Expect = 7e-85 Identities = 140/274 (51%), Positives = 201/274 (73%) Query: 61 LIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVFALIAWQI 120 +I + ++ I+W+ HF F + + + ++GFQ +L G+P + I V A +AW Sbjct: 1 MINIGQYIETAINWLTEHFASFFDALSMGIGGFIDGFQHVLFGIPFYITIAVLAALAWFK 60 Query: 121 SGVGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKII 180 SG G V TL+ L+ I +G W + M TLALVL++ +++G+PLGIW A S R KI+ Sbjct: 61 SGKGTAVFTLLGLLLIYGMGFWEETMQTLALVLSSTCLALLLGVPLGIWTANSDRCNKIM 120 Query: 181 RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEA 240 RP+LD MQT PAFVYL+P V+ FG+G VPG TIIFA+PP++RLT LGI QVP +++EA Sbjct: 121 RPVLDFMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180 Query: 241 SRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR 300 SRSFGA+P Q+L+KVQLPLA+PTI+ G+NQT+M++LSMVVIA+MI+ GGLG++VL+GI + Sbjct: 181 SRSFGATPWQLLYKVQLPLALPTILTGINQTIMMSLSMVVIAAMISAGGLGEIVLKGITQ 240 Query: 301 LDMGLATVGGVGIVILAIILDRLTQAVGRDSRSR 334 + +GL GG+ +VILAI+LDR+TQ + + +S+ Sbjct: 241 MKIGLGFEGGIAVVILAIVLDRITQGMADNRKSK 274 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 276 Length adjustment: 27 Effective length of query: 327 Effective length of database: 249 Effective search space: 81423 Effective search space used: 81423 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory