GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccB in Bacteroides thetaiotaomicron VPI-5482

Align Propionyl-CoA carboxylase beta chain; PCCase; Propanoyl-CoA:carbon dioxide ligase; EC 6.4.1.3 (characterized)
to candidate 351214 BT1686 propionyl-CoA carboxylase beta chain (NCBI ptt file)

Query= SwissProt::Q3J4E3
         (510 letters)



>lcl|FitnessBrowser__Btheta:351214 BT1686 propionyl-CoA carboxylase
           beta chain (NCBI ptt file)
          Length = 517

 Score =  650 bits (1678), Expect = 0.0
 Identities = 326/510 (63%), Positives = 392/510 (76%), Gaps = 4/510 (0%)

Query: 5   LQELENRRAIARAGGGQRRVEAQHKRGKLTARERIELLLDEGSFEEFDMFVRHRCTDFGM 64
           ++EL  RRA+AR GGG++ +  QH++GK TARERI +LLDEGSFEE DMFV HRCT+FGM
Sbjct: 8   IKELIERRAVARIGGGEKAIAKQHEKGKYTARERIAMLLDEGSFEEMDMFVEHRCTNFGM 67

Query: 65  QDDRPAGDGVVTGWGTINGRMVYVFSQDFTVFGGSLSETHAQKICKIMDMAMQNGAPVIG 124
           +     GDGVVTG GTI GR+VY+F+QDFTV  GSLSET + KICKIMD AM+ GAP IG
Sbjct: 68  EKKHYPGDGVVTGCGTIEGRLVYLFAQDFTVTAGSLSETMSLKICKIMDQAMKMGAPCIG 127

Query: 125 LNDSGGARIQEGVASLAGYADVFQRNIMASGVIPQISVIMGPCAGGAVYSPAMTDFIFMV 184
           +NDSGGARIQEG+ +LAGYA++FQRNI+ASGVIPQIS I GPCAGGAVYSPA+TDF  M+
Sbjct: 128 INDSGGARIQEGINALAGYAEIFQRNILASGVIPQISGIFGPCAGGAVYSPALTDFTLMM 187

Query: 185 RDTSYMFVTGPDVVKTVTNEVVTAEELGGASTHTKKSSVADGAFENDVEALYEIRRLVDF 244
             TSYMF+TGP VVKTVT E V+ E LGGAS H+ KS V     + + E L  IR L+ +
Sbjct: 188 EGTSYMFLTGPKVVKTVTGEDVSQENLGGASVHSTKSGVTHFTAKTEEEGLALIRTLLSY 247

Query: 245 LPLSNRTPAPVRPFFDDVARIEDSLDTLIPDNPNQPYDMKELILKIADEADFYEIQKDFA 304
           +P +N   AP     D + R+EDSL+ +IPD+PN+PYDM E+I  I D  +F EIQKD+A
Sbjct: 248 IPQNNLEEAPYVDCTDPIDRLEDSLNDIIPDSPNKPYDMYEVISAIVDNGEFLEIQKDYA 307

Query: 305 ANIITGFIRLEGQTVGVVANQPMVLAGCLDIDSSRKAARFVRFCDAFNIPILTLVDVPGF 364
            NII GF R  GQ+VG+VANQP  LAG LD ++SRK ARFVRFCDAFNIPI++LVDVPGF
Sbjct: 308 KNIIIGFARFNGQSVGIVANQPKFLAGVLDSNASRKGARFVRFCDAFNIPIVSLVDVPGF 367

Query: 365 LPGTGQEYGGVIKHGAKLLFAYGEATVPKVTVITRKAYGGAYDVMASKHLRGDFNYAWPT 424
           LPGTGQEY GVI HGAKLL+AYGEATVPKVT+  RK+YGG++ VM+ K LRGD NYAWPT
Sbjct: 368 LPGTGQEYNGVILHGAKLLYAYGEATVPKVTITLRKSYGGSHIVMSCKQLRGDMNYAWPT 427

Query: 425 AEIAVMGAKGATEILYRSELGDKEK----IAARAKEYEDRFANPFVAAERGFIDEVIMPH 480
           AEIAVMG  GA E+LY  E  D+E     +A +  EY   FANP+ AA+ G+ID+VI P 
Sbjct: 428 AEIAVMGGAGAVEVLYAREAKDQENPAQFLAEKEAEYTKLFANPYNAAKYGYIDDVIEPR 487

Query: 481 STRRRVSKAFASLRNKKLANPWKKHDNIPL 510
           +TR RV +A   L+ KKL+NP KKH NIPL
Sbjct: 488 NTRFRVIRALQQLQTKKLSNPAKKHGNIPL 517


Lambda     K      H
   0.321    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 756
Number of extensions: 23
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 510
Length of database: 517
Length adjustment: 35
Effective length of query: 475
Effective length of database: 482
Effective search space:   228950
Effective search space used:   228950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory