Align Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized)
to candidate 352022 BT2494 ABC transporter, ATP-binding protein (NCBI ptt file)
Query= TCDB::Q97Q42 (385 letters) >FitnessBrowser__Btheta:352022 Length = 238 Score = 138 bits (347), Expect = 2e-37 Identities = 88/247 (35%), Positives = 143/247 (57%), Gaps = 17/247 (6%) Query: 5 IIEFKNVSKVFED-SNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGD 63 +I+ +++K + + + VLK IN +++ G+F +++GASGSGKST+LNI+ L + TGD Sbjct: 1 MIKLTDINKTYNNGAPLHVLKGINLDIQRGEFVSIMGASGSGKSTLLNILGILDNYDTGD 60 Query: 64 IMLDGVRINDIPTNK------RDVHTVFQSYALFPHMNVFENVAFPLRLRKIDKKEIEQR 117 L+ V I D+ K R + +FQS+ L + ENVA PL + + +K+ Sbjct: 61 YYLNNVLIKDLSETKAAEYRNRMIGFIFQSFNLISFKDAVENVALPLFYQGVSRKKRNAL 120 Query: 118 VAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEPLSALDLKLRTDMQ 177 E L + L+ + ++SGGQ+QRVAIARA+I QP+++L DEP ALD K ++ Sbjct: 121 ALEYLDRLGLKEWAHHMPNEMSGGQKQRVAIARALITQPQIILADEPTGALDSKTSVEVM 180 Query: 178 YELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVDIYDEPINHFVATF 237 L++L R+G+T V VTH+ A +D I + DG I + +E ++H + F Sbjct: 181 QILKDL-HRMGMTIVVVTHESGVA-NQTDKIIHIKDGII-------ERIEENLDHDASPF 231 Query: 238 IGESNIL 244 G++ I+ Sbjct: 232 -GQNGIM 237 Lambda K H 0.318 0.138 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 238 Length adjustment: 27 Effective length of query: 358 Effective length of database: 211 Effective search space: 75538 Effective search space used: 75538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory