Align putrescine transport system permease protein PotH (characterized)
to candidate 350818 BT1290 putrescine transport system permease protein potH (NCBI ptt file)
Query= CharProtDB::CH_088338 (317 letters) >FitnessBrowser__Btheta:350818 Length = 258 Score = 145 bits (366), Expect = 1e-39 Identities = 77/218 (35%), Positives = 128/218 (58%), Gaps = 18/218 (8%) Query: 81 LNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVI 140 L L NF + + P + ++ S+ +A I+T C+L+GYP AW +++SK + +++L I Sbjct: 38 LTLANFQKFFEHPEAINTFVYSIGIAIITTLICILLGYPAAWILSNSKLNRSKTMVVLFI 97 Query: 141 LPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMV 200 LP W + L+R A + + + F + LG A+ G+VY ++PFM+ Sbjct: 98 LPMWVNILVRTLATVALF------DFFSVPLG-----------EGALIFGMVYNFIPFMI 140 Query: 201 LPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPE 260 PIY L ++D+S +EAA DLGA P++ FF ++PL+ G+++G M+VF+P + F I E Sbjct: 141 YPIYNTLQKMDHSYIEAAQDLGANPVQVFFKAVLPLSMPGVMSGIMMVFMPTISTFAIAE 200 Query: 261 LLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLL 298 LL + + G + QE NN W +A+++IMLLL+ Sbjct: 201 LLTMNNIKLFGTTI-QENINNSMWNYGAALSLIMLLLI 237 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 258 Length adjustment: 26 Effective length of query: 291 Effective length of database: 232 Effective search space: 67512 Effective search space used: 67512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory