Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 349829 BT0301 ATP-binding transport protein natA (Na+ ABC transporter) (NCBI ptt file)
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__Btheta:349829 Length = 503 Score = 72.0 bits (175), Expect = 2e-17 Identities = 49/158 (31%), Positives = 82/158 (51%), Gaps = 12/158 (7%) Query: 23 QAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEYLGKSIKGKGAWDLV 82 +A++GV FE++ G + L+G NGAGK+T M+ I G + G+I G + + Sbjct: 230 KALRGVSFEIQTG-MFGLLGPNGAGKSTLMRVICGIFEQSYGSIWINGLDTR------IY 282 Query: 83 KEGLV----MVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFTIFP-RLRERKD 137 +E L +P+ G + MT E L A ++ G L + + + ERKD Sbjct: 283 REELQSLIGFLPQEFGTYENMTSWEFLDYQAILKGIVDGDLRRERLDYVLKAVHMYERKD 342 Query: 138 QLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSP 175 + G+ SGG +Q + + L+ P++L++DEP+ GL P Sbjct: 343 EKIGSFSGGMKQRIGIALILLHLPRILVVDEPTAGLDP 380 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 503 Length adjustment: 29 Effective length of query: 213 Effective length of database: 474 Effective search space: 100962 Effective search space used: 100962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory