Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate 354204 BT4678 L-serine dehydratase (NCBI ptt file)
Query= reanno::acidovorax_3H11:Ac3H11_929 (466 letters) >FitnessBrowser__Btheta:354204 Length = 411 Score = 298 bits (762), Expect = 3e-85 Identities = 190/459 (41%), Positives = 252/459 (54%), Gaps = 67/459 (14%) Query: 4 SVFDLFKIGIGPSSSHTVGPMIAARQFACHVQGTLGLDAVHHVTVELFGSLSATGVGHGT 63 S+ +L++IG GPSSSHT+GP AA F V L+GSL+ATG GH T Sbjct: 12 SIKELYRIGTGPSSSHTMGPRKAAEMFVERHPDAASFK------VTLYGSLAATGKGHMT 65 Query: 64 DKAVLLGLAGHEPDHIDPDQILPAIADIRTRQTLALLGEHPVPFVEKEHLLFRRKSLPLH 123 D A++ D + PA PV V + + LP H Sbjct: 66 DVAII-------------DTLQPAA---------------PVEIVWQPKVF-----LPFH 92 Query: 124 PNGMAFHAFDAQGNEIATREYYSVGGGFVIDAAGERVLNSAATAGPDAVGHAQGLPHPFR 183 PNGM F A DA + YS+GGG + + + S G + + Sbjct: 93 PNGMTFAALDADNKILENWTVYSIGGGALAENNDNPTIESPEVYGMNNM----------- 141 Query: 184 TGAELLAQCQATGLTPAQLM--AANEQHWRSASEVRRQLMAIWKTMAGAVQRGCASTGTL 241 E+L C+ TG + + + NE W +EV W TM A+ RG + G L Sbjct: 142 --TEILQWCERTGKSYWEYVKECENEDIWDYLAEV-------WDTMKDAIHRGLEAEGVL 192 Query: 242 PGPMHVRRRAAELHHKLSSAPEAALRDPLSMLDWVNLYAMAVNEENAAGGRVVTAPTNGA 301 PGP+++RR+A+ + + + ++ L V YA+AV+EENA+GG++VTAPT G+ Sbjct: 193 PGPLNLRRKASTYYIRATGYKQS-----LQSRGLVFSYALAVSEENASGGKIVTAPTCGS 247 Query: 302 AGVIPAVLHYYVNFLPGANEDGIATFLLTAGAIGIIYKENASLSGAEVGCQGEVGVACSM 361 GV+PAVL Y++ ++ I L TAG IG I K NAS+SGAEVGCQGEVGVAC+M Sbjct: 248 CGVMPAVL-YHLQKSRDFSDMRILRALATAGLIGNIVKFNASISGAEVGCQGEVGVACAM 306 Query: 362 AAGALAAVMGGSPEQIENAAEIGMEHNLGMTCDPVGGLVQIPCIERNAMGAIKAINAARM 421 A+ A + GGSP QIE AAE+G+EH+LGMTCDPV GLVQIPCIERNA A +A++A Sbjct: 307 ASAAANQLFGGSPAQIEYAAEMGLEHHLGMTCDPVCGLVQIPCIERNAYAAARALDANLY 366 Query: 422 ALRGDGQHVVSLDKVIKTMMQTGADMKVKYKETSRGGLA 460 + DG H VS DKV++ M QTG D+ YKETS GGLA Sbjct: 367 SAFTDGMHRVSFDKVVQVMKQTGHDLPSLYKETSEGGLA 405 Lambda K H 0.319 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 411 Length adjustment: 32 Effective length of query: 434 Effective length of database: 379 Effective search space: 164486 Effective search space used: 164486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate 354204 BT4678 (L-serine dehydratase (NCBI ptt file))
to HMM TIGR00720 (L-serine ammonia-lyase (EC 4.3.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00720.hmm # target sequence database: /tmp/gapView.4609.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00720 [M=450] Accession: TIGR00720 Description: sda_mono: L-serine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-131 425.8 0.7 7.3e-112 360.4 0.1 2.0 2 lcl|FitnessBrowser__Btheta:354204 BT4678 L-serine dehydratase (NCB Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:354204 BT4678 L-serine dehydratase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.9 0.0 3.5e-22 3.5e-22 2 77 .. 12 81 .. 11 86 .. 0.91 2 ! 360.4 0.1 7.3e-112 7.3e-112 114 448 .. 84 406 .. 76 408 .. 0.93 Alignments for each domain: == domain 1 score: 64.9 bits; conditional E-value: 3.5e-22 TIGR00720 2 svfdlfkiGiGPssshtvGPmkaakefveelkkkgkleqvkrvkvdlyGslaltGkGhktdkavllGleGelpeev 77 s+ +l++iG GPsssht+GP kaa++fve+ ++ ++ kv+lyGsla+tGkGh td a++ l+ p e+ lcl|FitnessBrowser__Btheta:354204 12 SIKELYRIGTGPSSSHTMGPRKAAEMFVERHPDA------ASFKVTLYGSLAATGKGHMTDVAIIDTLQPAAPVEI 81 7889************************998655......899**********************99988877665 PP == domain 2 score: 360.4 bits; conditional E-value: 7.3e-112 TIGR00720 114 k.devlplhenglrlkaydeegevlkektyysvGGGfivdeeelkkeeeeeeevpypfksaaellelCkeeglsis 188 + + +lp+h+ng+++ a+d ++++l + t ys+GGG + ++++ + e+ y ++++e+l+ C+++g+s lcl|FitnessBrowser__Btheta:354204 84 QpKVFLPFHPNGMTFAALDADNKILENWTVYSIGGGALAENNDN---PTIESPEVYGMNNMTEILQWCERTGKSYW 156 546789******************************99776544...44555667********************9 PP TIGR00720 189 evvlenekalrseeevraklleiwkvmeecierglkaegvlpGglkvkrraaslkrklkakeetskdplavldwvn 264 e v e e +e++ ++l+e+w++m+++i+rgl+aegvlpG+l+++r+a++ + + + +++ l+ v lcl|FitnessBrowser__Btheta:354204 157 EYVKECE-----NEDIWDYLAEVWDTMKDAIHRGLEAEGVLPGPLNLRRKASTYYIRATGYKQS----LQSRGLVF 223 9998766.....47899************************************99887665555....67778999 PP TIGR00720 265 lyalavneenaaGgrvvtaPtnGaagiiPavlayykkfveeaseekvvrflltagaiGilykenasisgaevGCqg 340 yalav+eena+Gg++vtaPt G++g++Pavl++ + ++ s+ ++ r l tag iG + k nasisgaevGCqg lcl|FitnessBrowser__Btheta:354204 224 SYALAVSEENASGGKIVTAPTCGSCGVMPAVLYH-LQKSRDFSDMRILRALATAGLIGNIVKFNASISGAEVGCQG 298 9******************************955.5568899********************************** PP TIGR00720 341 evGvacsmaaaglaellggtpeqvenaaeiamehnlGltCdPvgGlvqiPCiernaiaavkainaarlalkedgkk 416 evGvac+ma+a+ +l+gg+p q+e aae+++eh+lG+tCdPv GlvqiPCierna aa +a++a + dg + lcl|FitnessBrowser__Btheta:354204 299 EVGVACAMASAAANQLFGGSPAQIEYAAEMGLEHHLGMTCDPVCGLVQIPCIERNAYAAARALDANLYSAFTDGMH 374 **************************************************************************** PP TIGR00720 417 kvsldkvietmretGkdmkakyketskgGlav 448 +vs+dkv+++m++tG+d+ + ykets+gGla+ lcl|FitnessBrowser__Btheta:354204 375 RVSFDKVVQVMKQTGHDLPSLYKETSEGGLAK 406 ******************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (450 nodes) Target sequences: 1 (411 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.07u 0.01s 00:00:00.08 Elapsed: 00:00:00.07 # Mc/sec: 2.48 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory