Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate 354204 BT4678 L-serine dehydratase (NCBI ptt file)
Query= reanno::acidovorax_3H11:Ac3H11_929 (466 letters) >lcl|FitnessBrowser__Btheta:354204 BT4678 L-serine dehydratase (NCBI ptt file) Length = 411 Score = 298 bits (762), Expect = 3e-85 Identities = 190/459 (41%), Positives = 252/459 (54%), Gaps = 67/459 (14%) Query: 4 SVFDLFKIGIGPSSSHTVGPMIAARQFACHVQGTLGLDAVHHVTVELFGSLSATGVGHGT 63 S+ +L++IG GPSSSHT+GP AA F V L+GSL+ATG GH T Sbjct: 12 SIKELYRIGTGPSSSHTMGPRKAAEMFVERHPDAASFK------VTLYGSLAATGKGHMT 65 Query: 64 DKAVLLGLAGHEPDHIDPDQILPAIADIRTRQTLALLGEHPVPFVEKEHLLFRRKSLPLH 123 D A++ D + PA PV V + + LP H Sbjct: 66 DVAII-------------DTLQPAA---------------PVEIVWQPKVF-----LPFH 92 Query: 124 PNGMAFHAFDAQGNEIATREYYSVGGGFVIDAAGERVLNSAATAGPDAVGHAQGLPHPFR 183 PNGM F A DA + YS+GGG + + + S G + + Sbjct: 93 PNGMTFAALDADNKILENWTVYSIGGGALAENNDNPTIESPEVYGMNNM----------- 141 Query: 184 TGAELLAQCQATGLTPAQLM--AANEQHWRSASEVRRQLMAIWKTMAGAVQRGCASTGTL 241 E+L C+ TG + + + NE W +EV W TM A+ RG + G L Sbjct: 142 --TEILQWCERTGKSYWEYVKECENEDIWDYLAEV-------WDTMKDAIHRGLEAEGVL 192 Query: 242 PGPMHVRRRAAELHHKLSSAPEAALRDPLSMLDWVNLYAMAVNEENAAGGRVVTAPTNGA 301 PGP+++RR+A+ + + + ++ L V YA+AV+EENA+GG++VTAPT G+ Sbjct: 193 PGPLNLRRKASTYYIRATGYKQS-----LQSRGLVFSYALAVSEENASGGKIVTAPTCGS 247 Query: 302 AGVIPAVLHYYVNFLPGANEDGIATFLLTAGAIGIIYKENASLSGAEVGCQGEVGVACSM 361 GV+PAVL Y++ ++ I L TAG IG I K NAS+SGAEVGCQGEVGVAC+M Sbjct: 248 CGVMPAVL-YHLQKSRDFSDMRILRALATAGLIGNIVKFNASISGAEVGCQGEVGVACAM 306 Query: 362 AAGALAAVMGGSPEQIENAAEIGMEHNLGMTCDPVGGLVQIPCIERNAMGAIKAINAARM 421 A+ A + GGSP QIE AAE+G+EH+LGMTCDPV GLVQIPCIERNA A +A++A Sbjct: 307 ASAAANQLFGGSPAQIEYAAEMGLEHHLGMTCDPVCGLVQIPCIERNAYAAARALDANLY 366 Query: 422 ALRGDGQHVVSLDKVIKTMMQTGADMKVKYKETSRGGLA 460 + DG H VS DKV++ M QTG D+ YKETS GGLA Sbjct: 367 SAFTDGMHRVSFDKVVQVMKQTGHDLPSLYKETSEGGLA 405 Lambda K H 0.319 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 411 Length adjustment: 32 Effective length of query: 434 Effective length of database: 379 Effective search space: 164486 Effective search space used: 164486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate 354204 BT4678 (L-serine dehydratase (NCBI ptt file))
to HMM TIGR00720 (L-serine ammonia-lyase (EC 4.3.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00720.hmm # target sequence database: /tmp/gapView.28615.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00720 [M=450] Accession: TIGR00720 Description: sda_mono: L-serine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-131 425.8 0.7 7.3e-112 360.4 0.1 2.0 2 lcl|FitnessBrowser__Btheta:354204 BT4678 L-serine dehydratase (NCB Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:354204 BT4678 L-serine dehydratase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.9 0.0 3.5e-22 3.5e-22 2 77 .. 12 81 .. 11 86 .. 0.91 2 ! 360.4 0.1 7.3e-112 7.3e-112 114 448 .. 84 406 .. 76 408 .. 0.93 Alignments for each domain: == domain 1 score: 64.9 bits; conditional E-value: 3.5e-22 TIGR00720 2 svfdlfkiGiGPssshtvGPmkaakefveelkkkgkleqvkrvkvdlyGslaltGkGhktdkavllGleGelpeev 77 s+ +l++iG GPsssht+GP kaa++fve+ ++ ++ kv+lyGsla+tGkGh td a++ l+ p e+ lcl|FitnessBrowser__Btheta:354204 12 SIKELYRIGTGPSSSHTMGPRKAAEMFVERHPDA------ASFKVTLYGSLAATGKGHMTDVAIIDTLQPAAPVEI 81 7889************************998655......899**********************99988877665 PP == domain 2 score: 360.4 bits; conditional E-value: 7.3e-112 TIGR00720 114 k.devlplhenglrlkaydeegevlkektyysvGGGfivdeeelkkeeeeeeevpypfksaaellelCkeeglsis 188 + + +lp+h+ng+++ a+d ++++l + t ys+GGG + ++++ + e+ y ++++e+l+ C+++g+s lcl|FitnessBrowser__Btheta:354204 84 QpKVFLPFHPNGMTFAALDADNKILENWTVYSIGGGALAENNDN---PTIESPEVYGMNNMTEILQWCERTGKSYW 156 546789******************************99776544...44555667********************9 PP TIGR00720 189 evvlenekalrseeevraklleiwkvmeecierglkaegvlpGglkvkrraaslkrklkakeetskdplavldwvn 264 e v e e +e++ ++l+e+w++m+++i+rgl+aegvlpG+l+++r+a++ + + + +++ l+ v lcl|FitnessBrowser__Btheta:354204 157 EYVKECE-----NEDIWDYLAEVWDTMKDAIHRGLEAEGVLPGPLNLRRKASTYYIRATGYKQS----LQSRGLVF 223 9998766.....47899************************************99887665555....67778999 PP TIGR00720 265 lyalavneenaaGgrvvtaPtnGaagiiPavlayykkfveeaseekvvrflltagaiGilykenasisgaevGCqg 340 yalav+eena+Gg++vtaPt G++g++Pavl++ + ++ s+ ++ r l tag iG + k nasisgaevGCqg lcl|FitnessBrowser__Btheta:354204 224 SYALAVSEENASGGKIVTAPTCGSCGVMPAVLYH-LQKSRDFSDMRILRALATAGLIGNIVKFNASISGAEVGCQG 298 9******************************955.5568899********************************** PP TIGR00720 341 evGvacsmaaaglaellggtpeqvenaaeiamehnlGltCdPvgGlvqiPCiernaiaavkainaarlalkedgkk 416 evGvac+ma+a+ +l+gg+p q+e aae+++eh+lG+tCdPv GlvqiPCierna aa +a++a + dg + lcl|FitnessBrowser__Btheta:354204 299 EVGVACAMASAAANQLFGGSPAQIEYAAEMGLEHHLGMTCDPVCGLVQIPCIERNAYAAARALDANLYSAFTDGMH 374 **************************************************************************** PP TIGR00720 417 kvsldkvietmretGkdmkakyketskgGlav 448 +vs+dkv+++m++tG+d+ + ykets+gGla+ lcl|FitnessBrowser__Btheta:354204 375 RVSFDKVVQVMKQTGHDLPSLYKETSEGGLAK 406 ******************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (450 nodes) Target sequences: 1 (411 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.07 # Mc/sec: 2.50 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory