Align L-serine dehydratase, alpha chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate 354204 BT4678 L-serine dehydratase (NCBI ptt file)
Query= uniprot:P33073 (292 letters) >FitnessBrowser__Btheta:354204 Length = 411 Score = 133 bits (334), Expect = 8e-36 Identities = 95/276 (34%), Positives = 134/276 (48%), Gaps = 10/276 (3%) Query: 2 LNTAREIIDVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSD 61 +N EI+ C G ++ V E E E+I L V D M + + L Sbjct: 138 MNNMTEILQWCERTGKSYWEYVKECE-------NEDIWDYLAEVWDTMKDAIHRGLEAEG 190 Query: 62 VTEYKMIDGFAKRTYEYANSGKSIVGDFLAKAMAMAFSTSEVNASMGKIVAAPTAGSSGI 121 V + TY +G + A + SE NAS GKIV APT GS G+ Sbjct: 191 VLPGPLNLRRKASTYYIRATGYKQSLQSRGLVFSYALAVSEENASGGKIVTAPTCGSCGV 250 Query: 122 MPAMLVAATEKYNFDRTTIQNGFLTSIGIGQVITKYATFAGAEGGCQAECGSASAMAAAA 181 MPA+L + +F I T+ IG ++ A+ +GAE GCQ E G A AMA+AA Sbjct: 251 MPAVLYHLQKSRDFSDMRILRALATAGLIGNIVKFNASISGAEVGCQGEVGVACAMASAA 310 Query: 182 LVEMLGGTVEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFISADLALAG 241 ++ GG+ Q +AA + + + LG+ CDP+ GLVQ PC RNA A + A+L A Sbjct: 311 ANQLFGGSPAQIEYAAEMGLEHHLGMTCDPVCGLVQIPCIERNAYAAARA-LDANLYSAF 369 Query: 242 VESL--VPFDEVVIAMGEVGNSMIEALRETGLGGLA 275 + + V FD+VV M + G+ + +ET GGLA Sbjct: 370 TDGMHRVSFDKVVQVMKQTGHDLPSLYKETSEGGLA 405 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 411 Length adjustment: 29 Effective length of query: 263 Effective length of database: 382 Effective search space: 100466 Effective search space used: 100466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory