Align Galactitol 2-dehydrogenase; GDH; Sorbitol dehydrogenase; SorbD; EC 1.1.1.16; EC 1.1.1.- (characterized)
to candidate 352759 BT3232 gluconate 5-dehydrogenase (NCBI ptt file)
Query= SwissProt::A9CES4 (256 letters) >FitnessBrowser__Btheta:352759 Length = 267 Score = 132 bits (332), Expect = 7e-36 Identities = 87/253 (34%), Positives = 128/253 (50%), Gaps = 7/253 (2%) Query: 3 LNNKVALITGAARGIGLGFAQAFAAEGAKVIIADID---IARATTSAAAIGPAAKAVKLD 59 L KVAL+TGA+ GIG A A+A +GA V DI+ + + + A G A D Sbjct: 9 LKGKVALVTGASYGIGFAIASAYAEQGATVCFNDINQELVDKGMAAYAEKGIKAHGYVCD 68 Query: 60 VTDLAQIDAVVKAVDEEFGGIDILVNNAAIFDMAPINGITEESYERVFDINLKGPMFMMK 119 VTD + A+V +++E G IDILVNNA I P++ + + RV DI+L P + K Sbjct: 69 VTDEPAVQAMVATIEKEVGTIDILVNNAGIIRRVPMHEMEAADFRRVIDIDLNAPFIVSK 128 Query: 120 AVSNVMIARARGGKIINMASQAGRRGEALVTLYCASKAAIISATQSAALALVKHGINVNA 179 AV M+ + R GKIIN+ S G V+ Y A+K + T++ ++ I N Sbjct: 129 AVLPAMM-KKRAGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNICSEYGEYNIQCNG 187 Query: 180 IAPGVVDGEHWEVVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASADS 239 I PG + + + +G + AK+ P GR+ P+++ G AVFLAS S Sbjct: 188 IGPGYIATP--QTAPLREKQADGSRHPFDSFICAKT-PAGRWLDPEELTGPAVFLASEAS 244 Query: 240 DYILAQTYNVDGG 252 + + VDGG Sbjct: 245 NAVNGHVLYVDGG 257 Lambda K H 0.319 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 267 Length adjustment: 25 Effective length of query: 231 Effective length of database: 242 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory