Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate 352759 BT3232 gluconate 5-dehydrogenase (NCBI ptt file)
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Btheta:352759 Length = 267 Score = 95.5 bits (236), Expect = 1e-24 Identities = 81/272 (29%), Positives = 125/272 (45%), Gaps = 24/272 (8%) Query: 1 MNTWLN--LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNY----- 53 MN +LN LK K+ VTG + GIG AI QGA V DI+ + Y Sbjct: 1 MNQYLNFSLKGKVALVTGASYGIGFAIASAYAEQGATVCFNDINQELVDKGMAAYAEKGI 60 Query: 54 --NFWPTDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAA 111 + + D++ V V I + G ID LVNNAG+ + P +E+ A Sbjct: 61 KAHGYVCDVTDEPAVQAMVATIEKEVGTIDILVNNAGII-------RRVPM--HEMEAAD 111 Query: 112 FEKMVNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFT 171 F ++++I+ F++S+AV M+K+R+G I+N+ S G E S YAA K L T Sbjct: 112 FRRVIDIDLNAPFIVSKAVLPAMMKKRAGKIINICSMMSELGRETVSAYAAAKGGLKMLT 171 Query: 172 RSWSKELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGR 231 R+ E G++ I+ G+ PG + T P E+ +R+ + + P GR Sbjct: 172 RNICSEYGEYNIQCNGIGPGYI-ATPQTAPLREKQADGSRHPF-----DSFICAKTPAGR 225 Query: 232 SGRLTEVADFVCYLLSERASYMTGVTTNIAGG 263 E+ +L SE ++ + G + GG Sbjct: 226 WLDPEELTGPAVFLASEASNAVNGHVLYVDGG 257 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory