Align Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 (characterized)
to candidate 349869 BT0341 Na+/glucose cotransporter (NCBI ptt file)
Query= SwissProt::P11170 (662 letters) >FitnessBrowser__Btheta:349869 Length = 523 Score = 261 bits (668), Expect = 4e-74 Identities = 159/532 (29%), Positives = 277/532 (52%), Gaps = 53/532 (9%) Query: 20 YERIRNAADISVIVIYFLVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNI 79 + + + D +++ YFL+++A+G+WA +G+ FLA S+ W IG S++ +N+ Sbjct: 2 HAKFLDTLDWGILIAYFLILIAIGIWASSKRKKGS--SLFLAEHSLRWHHIGFSMWGTNV 59 Query: 80 GSGHFVGLAGTGAASGIATGGFEWNALIMVVVLGWVFVPIYIRAGVVTMPEYLQKRFGGK 139 G + A G +GI +G + W A + + +L +VF P Y+ + V T+PE++ KRFG Sbjct: 60 GPSMLIASASAGFTTGIVSGNYAWYAFVFICLLAFVFAPRYLGSRVSTLPEFMGKRFGQS 119 Query: 140 RIQIYLSILSLLLYIFTKISADIFSGAIFIQLTLGLDIYVAIIILLVITGLYTITGGLAA 199 I L+ +++ + + ++ +F+G + I+ + ++ + +ILL+I+ +T+ GGL A Sbjct: 120 TRNI-LAWYTIVTILISWLALTLFAGGVLIRQVFDIPMWQSALILLIISAFFTMLGGLKA 178 Query: 200 VIYTDTLQTAIMMVGSVILTGFAFHEVGGYEAFTEKYMRAIPSQISYGNTSIPQKCYTPR 259 V YT+ Q ++++ S L ++VGG A T+ A+P+ Sbjct: 179 VAYTNVYQMILLILVSAALAIVGIYKVGGISALTD----AVPA----------------- 217 Query: 260 EDAFHIFRDAITGDIPWPGLVFGMSILTLWYWCTDQVIVQRCLSAKNLSHVKAGCILCGY 319 D +++FR PW ++ G ++ +W+WCTDQ +VQ L+AK+L + G G+ Sbjct: 218 -DFWNLFRPNDDTAFPWLPIILGYPVMGVWFWCTDQSMVQPVLAAKSLKEGQLGTNFTGW 276 Query: 320 LKVMPMFLIVMMGMVSRILYTDKVACVVPSECERYCGTRVGCTNIAFPTLVVELMPNGLR 379 LK++ + L ++ G++ L+ P E A+ T+V L P G+ Sbjct: 277 LKILDVPLYILPGIICLALFPQ---LENPDE--------------AYMTMVTHLFPVGMV 319 Query: 380 GLMLSVMMASLMSSLTSIFNSASTLFTMDIYT-KIRKKASEKELMIAGRLFMLFLIGISI 438 GL+L+V+ A+L+S++ S N+ ST+FTMDIY KIR +A +KE++ G++ + IS+ Sbjct: 320 GLVLAVLTAALVSTIGSALNALSTVFTMDIYVKKIRPQAKQKEIIRVGQVVTVAGALISV 379 Query: 439 AWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLVLGFLIGIS 498 + S LF+ QS+ ++ PP+AAVFL +FWKR A L +G Sbjct: 380 IITIAIDSIHGLNLFNVFQSVLGFIAPPMAAVFLFGVFWKRTTTLAANAALTVG------ 433 Query: 499 RMITEFAYGTGSC-MEPSNCPTIICGVHYLYFAIILFVISIITVVVVSLFTK 549 T F+ G G + H++ + LFVI I +VVV L K Sbjct: 434 ---TVFSIGVGVLYLWVFPADQYSAWPHFMLLSFYLFVIIGIGMVVVGLLDK 482 Lambda K H 0.327 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 839 Number of extensions: 42 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 662 Length of database: 523 Length adjustment: 37 Effective length of query: 625 Effective length of database: 486 Effective search space: 303750 Effective search space used: 303750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory