Align hexokinase (EC 2.7.1.1) (characterized)
to candidate 351958 BT2430 hexokinase type III (NCBI ptt file)
Query= BRENDA::P50521 (455 letters) >FitnessBrowser__Btheta:351958 Length = 402 Score = 121 bits (304), Expect = 4e-32 Identities = 96/290 (33%), Positives = 141/290 (48%), Gaps = 21/290 (7%) Query: 14 NDFEYPTESLREAVKEFDELRQKGLQKNGEVLAMAPAFISTLPTGAETGDFLALDFGGTN 73 N F+ E L+ V F + ++GL+ + P FI+ T + G L LD GGTN Sbjct: 4 NIFKLDNEQLKAIVCSFRDKTEEGLKTENAEIQCIPTFIAPKTTHIK-GKSLVLDLGGTN 62 Query: 74 LRVCWIQLLGDGKYEMKHSKSVLPRECVRNE-SVKPIIDFMSDHVELFIKEHFPSKFGCP 132 RV + K + +V P + + S+ + + + ELF KE G Sbjct: 63 YRVAIVDF-------DKATPTVHPNNGWKKDMSIMKSVGYTRE--ELF-KELADMIIGIK 112 Query: 133 EEEYLPMGFTFSYPANQVSITESYLLRWTKGLNIPEA----INKDFAQFLTEGFKARNLP 188 EE +P+G+ FSYPA V ++ LLRWTKG++I E I K +L E K + Sbjct: 113 REEEMPIGYCFSYPAESVPGGDAKLLRWTKGVDIKEMVGEFIGKPLLDYLNERNKIKFTG 172 Query: 189 IRIEAVINDTVGTLVTRAYTSKESDTFMGIIFGTGTNGAYVEQMNQIPKLAGKCTGDHML 248 I+ V+NDT+ +L T D ++G+I GTGTN A ++I KL C H L Sbjct: 173 IK---VVNDTIASLFA-GLTDNSYDAYIGLIVGTGTNMATFIPADKIEKLDQSCNA-HGL 227 Query: 249 INMEWGATDFSCLHSTRYDLLLDHDTPNAGRQIFEKRVGGMYLGELFRRA 298 I + + +F T D +D + N G+Q FEK V GMYLG++ + A Sbjct: 228 IPVNLESGNFHPPFLTAVDDTVDAISGNPGKQRFEKAVSGMYLGDILKTA 277 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 402 Length adjustment: 32 Effective length of query: 423 Effective length of database: 370 Effective search space: 156510 Effective search space used: 156510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory