Align fructokinase (EC 2.7.1.4) (characterized)
to candidate 352326 BT2799 putative PfkB family carbohydrate kinase (NCBI ptt file)
Query= BRENDA::Q6VWJ5 (386 letters) >FitnessBrowser__Btheta:352326 Length = 329 Score = 77.8 bits (190), Expect = 4e-19 Identities = 74/247 (29%), Positives = 113/247 (45%), Gaps = 16/247 (6%) Query: 96 APGGAPANVAVGISRLGGSSAFIGKVGEDEFGYMLAEILKENNVNSDGMRFDPGARTALA 155 A GG+ N +G++ LG + FIGKVG D +G + L++NN+ D + + +A Sbjct: 57 ATGGSAGNAILGLACLGAGTGFIGKVGNDHYGDFFRKNLQKNNI-EDNLLTSEQLPSGVA 115 Query: 156 FVTLRKDGEREFMFYRNPSADMLLQEDELDLELIRKAKVFHYGSISLITEPCKSAHIAAA 215 + +DGER F Y +A L+ ++L LE+ K + Y I + A Sbjct: 116 STFISQDGERTFGTYLGAAAS--LKAEDLTLEMF---KGYAYLFIEGYLVQDHEMILHAI 170 Query: 216 KAAKDAGVILSYDPNLRLPLWPSAESAREGI-LSIWNTADIIKISEEEISFLTQGEDPYD 274 + AK+AG+ + D + + E+ E L I DI+ +EEE T GE+P + Sbjct: 171 ELAKEAGLQICLD----MASYNIVENDLEFFSLLINKYVDIVFANEEEAKAFT-GEEPEE 225 Query: 275 DNVVRKLYHPNLKLLLVTEGPEGCRYYTKDFSGRVKGIKVDAV-DTTGAGDAFVAGILSQ 333 ++ + +V G G +V I V+ V DTTGAGD F AG L Sbjct: 226 ---ALRVIAKKCSIAIVKVGANGSYIRKGTEEIKVSAIPVEKVLDTTGAGDYFAAGFLYG 282 Query: 334 LASDVSL 340 L SL Sbjct: 283 LTCGYSL 289 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 329 Length adjustment: 29 Effective length of query: 357 Effective length of database: 300 Effective search space: 107100 Effective search space used: 107100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory