Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate 353219 BT3693 acetate kinase (NCBI ptt file)
Query= BRENDA::Q9WYB1 (403 letters) >FitnessBrowser__Btheta:353219 Length = 399 Score = 466 bits (1199), Expect = e-136 Identities = 235/401 (58%), Positives = 304/401 (75%), Gaps = 3/401 (0%) Query: 1 MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRVGD-EKHVIERELPDH 59 M++LV+N GSSSIKY+L +M ++V+ +G E+IG++GS L + + EK V+E+++P+H Sbjct: 1 MKILVLNCGSSSIKYKLFDMTTKEVIAQGGIEKIGLKGSFLKLTLPNGEKKVLEKDIPEH 60 Query: 60 EEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLA 119 ++ ILNTL+ + G IK L EI+AVGHR+VHGGERF ESVL+++EVL+A + LA Sbjct: 61 TIGVEFILNTLISPEYGAIKSLDEINAVGHRMVHGGERFSESVLLNKEVLEAFAACNDLA 120 Query: 120 PLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRRYGFH 179 PLHNPANL G+ A +LP +P V VFDTAFHQT+P AY+YAIPYE YEKY +RRYGFH Sbjct: 121 PLHNPANLKGVNAVSAILPNIPQVGVFDTAFHQTMPDYAYMYAIPYEMYEKYGVRRYGFH 180 Query: 180 GTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGT 239 GTSHRYVSKR E LG KIITCHIGNG S+AA+K GKC+DT+MG TPLEGL+MGT Sbjct: 181 GTSHRYVSKRVCEFLGVNPVGQKIITCHIGNGGSIAAIKDGKCIDTTMGLTPLEGLMMGT 240 Query: 240 RSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGDEWCK 299 RSGD+D FIMEKEG++ + ++LNKKSGV G+S G SSDMR++ A G+E Sbjct: 241 RSGDIDAGAVTFIMEKEGLNTTGISNLLNKKSGVLGIS-GVSSDMRELLAACANGNERAI 299 Query: 300 LVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKN 359 L ++Y YRI KYIGAYAAA+ GVD I+FT GVGEN RE VC +EF+G+KLD N Sbjct: 300 LAEKMYYYRIKKYIGAYAAALGGVDIILFTGGVGENQFECRESVCKDMEFMGIKLDNNVN 359 Query: 360 EETIRGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIVEK 400 + +RG+E IIST DS+VKV+V+PT+EEL+IA DT +I++K Sbjct: 360 AK-VRGEEAIISTADSKVKVVVIPTDEELLIASDTMDILKK 399 Lambda K H 0.318 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 399 Length adjustment: 31 Effective length of query: 372 Effective length of database: 368 Effective search space: 136896 Effective search space used: 136896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 353219 BT3693 (acetate kinase (NCBI ptt file))
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.8586.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-162 526.7 0.7 2e-162 526.5 0.7 1.0 1 lcl|FitnessBrowser__Btheta:353219 BT3693 acetate kinase (NCBI ptt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353219 BT3693 acetate kinase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 526.5 0.7 2e-162 2e-162 4 403 .. 1 396 [. 1 398 [. 0.98 Alignments for each domain: == domain 1 score: 526.5 bits; conditional E-value: 2e-162 TIGR00016 4 kkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkllntlkk.d 78 +kilvln+Gsss+k++l+d++ +++v+++g +e+i l+++++k +++k+ +++i++h+ +v+++lntl + + lcl|FitnessBrowser__Btheta:353219 1 MKILVLNCGSSSIKYKLFDMT-TKEVIAQGGIEKIGLKGSFLKLTLPNGEKKVLEKDIPEHTIGVEFILNTLISpE 75 69*******************.59999**********************************************999 PP TIGR00016 79 kkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvavFDt 154 +k+l+ei+++GHR+vhGge+f+esv++++evl++ + +lAPlHnpa+l+g++av+ +l++ ++v vFDt lcl|FitnessBrowser__Btheta:353219 76 YGAIKSLDEINAVGHRMVHGGERFSESVLLNKEVLEAFAACNDLAPLHNPANLKGVNAVS--AILPNIPQVGVFDT 149 9***********************************************************..999*********** PP TIGR00016 155 afHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknGksid 230 afHqt+p+ ay+Ya+Py++y+++gvRrYGfHGtsh+yv++r+ + l+ + ++i+cH+GnG+s++a+k+Gk+id lcl|FitnessBrowser__Btheta:353219 150 AFHQTMPDYAYMYAIPYEMYEKYGVRRYGFHGTSHRYVSKRVCEFLGVNPVGQKIITCHIGNGGSIAAIKDGKCID 225 ************************************************9999************************ PP TIGR00016 231 tsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegneeaklA 306 t+mGltPLeGl+mGtRsGdiD +++++++e++gl + i ++lnkksG+lgisg+ssD+R++l++ ++gne+a lA lcl|FitnessBrowser__Btheta:353219 226 TTMGLTPLEGLMMGTRSGDIDAGAVTFIMEKEGLNTTGISNLLNKKSGVLGISGVSSDMRELLAACANGNERAILA 301 **************************************************************************** PP TIGR00016 307 lkvyvhRiakyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvisteesk 382 k+y +Ri+kyig+y+a+l g +D i+FtgG+Gen+ e+re v++++e++G+kld++ n +g+e++ist +sk lcl|FitnessBrowser__Btheta:353219 302 EKMYYYRIKKYIGAYAAALGG-VDIILFTGGVGENQFECRESVCKDMEFMGIKLDNNVNA-KVRGEEAIISTADSK 375 *******************76.************************************99.7899*********** PP TIGR00016 383 vkvlviptneelviaeDalrl 403 vkv+vipt+eel+ia D++ + lcl|FitnessBrowser__Btheta:353219 376 VKVVVIPTDEELLIASDTMDI 396 *****************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory