Align Methylmalonyl-CoA epimerase; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 (characterized)
to candidate 351213 BT1685 lactoylglutathione lyase and related protein (NCBI ptt file)
Query= SwissProt::O58010 (136 letters) >FitnessBrowser__Btheta:351213 Length = 134 Score = 135 bits (339), Expect = 3e-37 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 2/128 (1%) Query: 8 IDHVGIAVKNLEEAIKIWEG-LGFKVEEIEEVPDQKVKVAVIKVGENRIELLEATTEDSP 66 I+H+GIAVK++EEA+ +E LG K IE V DQKV+ A +KVGE +IELLE T +S Sbjct: 6 IEHLGIAVKSIEEALPYYENVLGLKCYNIETVEDQKVRTAFLKVGETKIELLEPTCPEST 65 Query: 67 IAKFIEKRGEGIHHLAIRVEN-IESKLEELKQKGYKLIDEKPRVGAGGAKIAFIHPKSVT 125 IAKFIE +G G+HH+A VE+ + + L E + K +LID+ PR GA G IAF+HPKS Sbjct: 66 IAKFIENKGAGVHHVAFAVEDGVANALAEAESKEIRLIDKAPRKGAEGLNIAFLHPKSTL 125 Query: 126 GVLLELCE 133 GVL ELCE Sbjct: 126 GVLTELCE 133 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 94 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 136 Length of database: 134 Length adjustment: 15 Effective length of query: 121 Effective length of database: 119 Effective search space: 14399 Effective search space used: 14399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)
Align candidate 351213 BT1685 (lactoylglutathione lyase and related protein (NCBI ptt file))
to HMM TIGR03081 (mce: methylmalonyl-CoA epimerase (EC 5.1.99.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03081.hmm # target sequence database: /tmp/gapView.14027.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03081 [M=129] Accession: TIGR03081 Description: metmalonyl_epim: methylmalonyl-CoA epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-48 150.9 0.3 1.6e-48 150.7 0.3 1.0 1 lcl|FitnessBrowser__Btheta:351213 BT1685 lactoylglutathione lyase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351213 BT1685 lactoylglutathione lyase and related protein (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.7 0.3 1.6e-48 1.6e-48 1 129 [] 5 133 .. 5 133 .. 0.98 Alignments for each domain: == domain 1 score: 150.7 bits; conditional E-value: 1.6e-48 TIGR03081 1 kldhvaiavkdleeaaklyrdvlGakvseeeelpeqgvkvvflelgetklellepleedspiakflekkkgeGlhh 76 +++h++iavk++eea +y++vlG+k + e++++q+v+++fl++getk+ellep+ +s+iakf+e+k g G+hh lcl|FitnessBrowser__Btheta:351213 5 HIEHLGIAVKSIEEALPYYENVLGLKCYNIETVEDQKVRTAFLKVGETKIELLEPTCPESTIAKFIENK-GAGVHH 79 699****************************************************************99.****** PP TIGR03081 77 ialevdd.ieaaletlkekgvrlldeepriGahGkkvaFlhPkdtgGvLielee 129 +a++v+d + +al++++ k++rl+d++pr Ga G ++aFlhPk+t GvL+el+e lcl|FitnessBrowser__Btheta:351213 80 VAFAVEDgVANALAEAESKEIRLIDKAPRKGAEGLNIAFLHPKSTLGVLTELCE 133 *****886899*****************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (129 nodes) Target sequences: 1 (134 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 4.36 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory