Align 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) (characterized)
to candidate 350899 BT1371 2-amino-3-ketobutyrate coenzyme A ligase (NCBI ptt file)
Query= reanno::ANA3:7026975 (397 letters) >FitnessBrowser__Btheta:350899 Length = 395 Score = 468 bits (1203), Expect = e-136 Identities = 237/388 (61%), Positives = 292/388 (75%), Gaps = 2/388 (0%) Query: 10 INQQLADVKAEGLYKSERVIASPQQTAIQVNHQEVVNFCANNYLGLANHPELIKAAQQGL 69 ++Q LA++K GLYK ER+I S QQ AI V +EV+NFCANNYLGL+NHP LIKA+Q+ + Sbjct: 9 LSQTLAEIKEAGLYKEERLIESAQQAAITVKGKEVLNFCANNYLGLSNHPRLIKASQEMM 68 Query: 70 DSHGFGMASVRFICGTQDIHKQLEASLSEFLGMEDTILYSSCFDANAGLFETLLDAEDAI 129 + GFGM+SVRFICGTQDIHK+LEA++S++ EDTILY++CFDAN G+FE L EDAI Sbjct: 69 ERRGFGMSSVRFICGTQDIHKELEAAISDYFQTEDTILYAACFDANGGVFEPLFSEEDAI 128 Query: 130 ISDALNHASIIDGVRLCKAKRFRYANNDMADLETQLIAAKAAGARNILIATDGVFSMDGV 189 ISD+LNHASIIDGVRLCKAKR+RYAN DM DLE L A+A R ++ TDGVFSMDG Sbjct: 129 ISDSLNHASIIDGVRLCKAKRYRYANADMKDLERCLQEAQAQRFR--IVVTDGVFSMDGN 186 Query: 190 IANLQGVCDLADKYGALVMVDDSHAVGFVGLNGRGSHEHCGVMGRVDIITGTLGKALGGA 249 +A + +CDLA+KY ALVMVD+SH+ G VG G G E GRVDI TGTLGKA GGA Sbjct: 187 VAPMDQICDLAEKYDALVMVDESHSAGVVGATGHGVSELYKTYGRVDIYTGTLGKAFGGA 246 Query: 250 SGGFTSGKKEVIDWLRQRSRPYLFSNSLAPSIVTASIHVLEMLKSGQALREAVWENSRYF 309 GGFT+G+KE+ID LRQRSRPYLFSNSLAP I+ AS+ V +MLK AL + + EN YF Sbjct: 247 LGGFTTGRKEIIDLLRQRSRPYLFSNSLAPGIIGASLEVFKMLKESNALHDKLVENVNYF 306 Query: 310 REKMSAAGFTLGGADHAIIPVMIGDAKLASDFANRLLAEHIYVIGFSFPVVPKGQARIRT 369 R++M+AAGF + AI VM+ DAKL+ +A R+ E IYV GF +PVVPK QARIR Sbjct: 307 RDQMTAAGFDIKPTQSAICAVMLHDAKLSQIYAARMQEEGIYVTGFYYPVVPKEQARIRV 366 Query: 370 QMSAAHTREQLDKAIEAFTRIAKEMAII 397 Q+SA H + LDK I AF ++ KE+ + Sbjct: 367 QISAGHEKAHLDKCIAAFIKVGKELGTL 394 Lambda K H 0.321 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate 350899 BT1371 (2-amino-3-ketobutyrate coenzyme A ligase (NCBI ptt file))
to HMM TIGR01822 (kbl: glycine C-acetyltransferase (EC 2.3.1.29))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01822.hmm # target sequence database: /tmp/gapView.15353.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01822 [M=393] Accession: TIGR01822 Description: 2am3keto_CoA: glycine C-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-210 685.0 2.4 1.7e-210 684.8 2.4 1.0 1 lcl|FitnessBrowser__Btheta:350899 BT1371 2-amino-3-ketobutyrate co Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:350899 BT1371 2-amino-3-ketobutyrate coenzyme A ligase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 684.8 2.4 1.7e-210 1.7e-210 1 392 [. 5 393 .. 5 394 .. 0.99 Alignments for each domain: == domain 1 score: 684.8 bits; conditional E-value: 1.7e-210 TIGR01822 1 lkailaaelesireaGlfkkeriitspqkadirvadGrevlnfcannylGlsdhpeviqaakdaldehGfGlssvr 76 +k++l++ l i+eaGl+k+er+i s+q+a i+v +G+evlnfcannylGls+hp++i+a+++ ++ +GfG+ssvr lcl|FitnessBrowser__Btheta:350899 5 MKEHLSQTLAEIKEAGLYKEERLIESAQQAAITV-KGKEVLNFCANNYLGLSNHPRLIKASQEMMERRGFGMSSVR 79 688999****************************.9**************************************** PP TIGR01822 77 ficGtqdlhkelekklaeflgtedailyascfdangGlfeallgeedaiisdalnhasiidGvrlckakryryena 152 ficGtqd+hkele++++++++ted+ilya+cfdangG+fe+l++eedaiisd+lnhasiidGvrlckakryry+na lcl|FitnessBrowser__Btheta:350899 80 FICGTQDIHKELEAAISDYFQTEDTILYAACFDANGGVFEPLFSEEDAIISDSLNHASIIDGVRLCKAKRYRYANA 155 **************************************************************************** PP TIGR01822 153 dledleaklkearaagarlrliatdGvfsmdGtiapldeicalaekydalvlvdechatGflGatGrGsaelldvl 228 d++dle+ l+ea+a+ r r+++tdGvfsmdG++ap+d+ic+laekydalv+vde+h++G++GatG G++el + lcl|FitnessBrowser__Btheta:350899 156 DMKDLERCLQEAQAQ--RFRIVVTDGVFSMDGNVAPMDQICDLAEKYDALVMVDESHSAGVVGATGHGVSELYKTY 229 ***************..*********************************************************** PP TIGR01822 229 dkvdiitgtlGkalGGasGGfttakkevvellrqrsrpylfsnslapavvgasikvlelleasnelrdklventry 304 ++vdi+tgtlGka+GGa+GGftt++ke+++llrqrsrpylfsnslap ++gas++v+++l++sn l+dklven++y lcl|FitnessBrowser__Btheta:350899 230 GRVDIYTGTLGKAFGGALGGFTTGRKEIIDLLRQRSRPYLFSNSLAPGIIGASLEVFKMLKESNALHDKLVENVNY 305 **************************************************************************** PP TIGR01822 305 frekleaaGfdvkpaehaiipvmlydaklaqklaerlleeGiyviGffypvvpkGqarirvqlsaaheeeqldkav 380 fr++++aaGfd+kp+++ai++vml+dakl+q +a+r++eeGiyv+Gf+ypvvpk qarirvq+sa+he+++ldk++ lcl|FitnessBrowser__Btheta:350899 306 FRDQMTAAGFDIKPTQSAICAVMLHDAKLSQIYAARMQEEGIYVTGFYYPVVPKEQARIRVQISAGHEKAHLDKCI 381 **************************************************************************** PP TIGR01822 381 eafvkvGrelgv 392 af+kvG+elg lcl|FitnessBrowser__Btheta:350899 382 AAFIKVGKELGT 393 *********996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (395 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory