Align 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) (characterized)
to candidate 350899 BT1371 2-amino-3-ketobutyrate coenzyme A ligase (NCBI ptt file)
Query= reanno::ANA3:7026975 (397 letters) >FitnessBrowser__Btheta:350899 Length = 395 Score = 468 bits (1203), Expect = e-136 Identities = 237/388 (61%), Positives = 292/388 (75%), Gaps = 2/388 (0%) Query: 10 INQQLADVKAEGLYKSERVIASPQQTAIQVNHQEVVNFCANNYLGLANHPELIKAAQQGL 69 ++Q LA++K GLYK ER+I S QQ AI V +EV+NFCANNYLGL+NHP LIKA+Q+ + Sbjct: 9 LSQTLAEIKEAGLYKEERLIESAQQAAITVKGKEVLNFCANNYLGLSNHPRLIKASQEMM 68 Query: 70 DSHGFGMASVRFICGTQDIHKQLEASLSEFLGMEDTILYSSCFDANAGLFETLLDAEDAI 129 + GFGM+SVRFICGTQDIHK+LEA++S++ EDTILY++CFDAN G+FE L EDAI Sbjct: 69 ERRGFGMSSVRFICGTQDIHKELEAAISDYFQTEDTILYAACFDANGGVFEPLFSEEDAI 128 Query: 130 ISDALNHASIIDGVRLCKAKRFRYANNDMADLETQLIAAKAAGARNILIATDGVFSMDGV 189 ISD+LNHASIIDGVRLCKAKR+RYAN DM DLE L A+A R ++ TDGVFSMDG Sbjct: 129 ISDSLNHASIIDGVRLCKAKRYRYANADMKDLERCLQEAQAQRFR--IVVTDGVFSMDGN 186 Query: 190 IANLQGVCDLADKYGALVMVDDSHAVGFVGLNGRGSHEHCGVMGRVDIITGTLGKALGGA 249 +A + +CDLA+KY ALVMVD+SH+ G VG G G E GRVDI TGTLGKA GGA Sbjct: 187 VAPMDQICDLAEKYDALVMVDESHSAGVVGATGHGVSELYKTYGRVDIYTGTLGKAFGGA 246 Query: 250 SGGFTSGKKEVIDWLRQRSRPYLFSNSLAPSIVTASIHVLEMLKSGQALREAVWENSRYF 309 GGFT+G+KE+ID LRQRSRPYLFSNSLAP I+ AS+ V +MLK AL + + EN YF Sbjct: 247 LGGFTTGRKEIIDLLRQRSRPYLFSNSLAPGIIGASLEVFKMLKESNALHDKLVENVNYF 306 Query: 310 REKMSAAGFTLGGADHAIIPVMIGDAKLASDFANRLLAEHIYVIGFSFPVVPKGQARIRT 369 R++M+AAGF + AI VM+ DAKL+ +A R+ E IYV GF +PVVPK QARIR Sbjct: 307 RDQMTAAGFDIKPTQSAICAVMLHDAKLSQIYAARMQEEGIYVTGFYYPVVPKEQARIRV 366 Query: 370 QMSAAHTREQLDKAIEAFTRIAKEMAII 397 Q+SA H + LDK I AF ++ KE+ + Sbjct: 367 QISAGHEKAHLDKCIAAFIKVGKELGTL 394 Lambda K H 0.321 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate 350899 BT1371 (2-amino-3-ketobutyrate coenzyme A ligase (NCBI ptt file))
to HMM TIGR01822 (kbl: glycine C-acetyltransferase (EC 2.3.1.29))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01822.hmm # target sequence database: /tmp/gapView.29834.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01822 [M=393] Accession: TIGR01822 Description: 2am3keto_CoA: glycine C-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-210 685.0 2.4 1.7e-210 684.8 2.4 1.0 1 lcl|FitnessBrowser__Btheta:350899 BT1371 2-amino-3-ketobutyrate co Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:350899 BT1371 2-amino-3-ketobutyrate coenzyme A ligase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 684.8 2.4 1.7e-210 1.7e-210 1 392 [. 5 393 .. 5 394 .. 0.99 Alignments for each domain: == domain 1 score: 684.8 bits; conditional E-value: 1.7e-210 TIGR01822 1 lkailaaelesireaGlfkkeriitspqkadirvadGrevlnfcannylGlsdhpeviqaakdaldehGfGlssvr 76 +k++l++ l i+eaGl+k+er+i s+q+a i+v +G+evlnfcannylGls+hp++i+a+++ ++ +GfG+ssvr lcl|FitnessBrowser__Btheta:350899 5 MKEHLSQTLAEIKEAGLYKEERLIESAQQAAITV-KGKEVLNFCANNYLGLSNHPRLIKASQEMMERRGFGMSSVR 79 688999****************************.9**************************************** PP TIGR01822 77 ficGtqdlhkelekklaeflgtedailyascfdangGlfeallgeedaiisdalnhasiidGvrlckakryryena 152 ficGtqd+hkele++++++++ted+ilya+cfdangG+fe+l++eedaiisd+lnhasiidGvrlckakryry+na lcl|FitnessBrowser__Btheta:350899 80 FICGTQDIHKELEAAISDYFQTEDTILYAACFDANGGVFEPLFSEEDAIISDSLNHASIIDGVRLCKAKRYRYANA 155 **************************************************************************** PP TIGR01822 153 dledleaklkearaagarlrliatdGvfsmdGtiapldeicalaekydalvlvdechatGflGatGrGsaelldvl 228 d++dle+ l+ea+a+ r r+++tdGvfsmdG++ap+d+ic+laekydalv+vde+h++G++GatG G++el + lcl|FitnessBrowser__Btheta:350899 156 DMKDLERCLQEAQAQ--RFRIVVTDGVFSMDGNVAPMDQICDLAEKYDALVMVDESHSAGVVGATGHGVSELYKTY 229 ***************..*********************************************************** PP TIGR01822 229 dkvdiitgtlGkalGGasGGfttakkevvellrqrsrpylfsnslapavvgasikvlelleasnelrdklventry 304 ++vdi+tgtlGka+GGa+GGftt++ke+++llrqrsrpylfsnslap ++gas++v+++l++sn l+dklven++y lcl|FitnessBrowser__Btheta:350899 230 GRVDIYTGTLGKAFGGALGGFTTGRKEIIDLLRQRSRPYLFSNSLAPGIIGASLEVFKMLKESNALHDKLVENVNY 305 **************************************************************************** PP TIGR01822 305 frekleaaGfdvkpaehaiipvmlydaklaqklaerlleeGiyviGffypvvpkGqarirvqlsaaheeeqldkav 380 fr++++aaGfd+kp+++ai++vml+dakl+q +a+r++eeGiyv+Gf+ypvvpk qarirvq+sa+he+++ldk++ lcl|FitnessBrowser__Btheta:350899 306 FRDQMTAAGFDIKPTQSAICAVMLHDAKLSQIYAARMQEEGIYVTGFYYPVVPKEQARIRVQISAGHEKAHLDKCI 381 **************************************************************************** PP TIGR01822 381 eafvkvGrelgv 392 af+kvG+elg lcl|FitnessBrowser__Btheta:350899 382 AAFIKVGKELGT 393 *********996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (395 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.72 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory