Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate 350898 BT1370 NAD dependent nucleotide-diphosphate-sugar epimerase (NCBI ptt file)
Query= BRENDA::E3PS87 (319 letters) >FitnessBrowser__Btheta:350898 Length = 318 Score = 395 bits (1015), Expect = e-115 Identities = 192/316 (60%), Positives = 243/316 (76%), Gaps = 1/316 (0%) Query: 1 MRKILITGSLGQIGTELTMFLREQYGNDNVIASDLTNNGPENVLT-SGPFESLDILDAKK 59 M+ ILI G+ GQIG+ELTM LR +YGN NV+A + P+ L SGP +D+ + + Sbjct: 1 MKHILIIGATGQIGSELTMELRRRYGNTNVVAGYIQGAEPKGELKESGPSAVVDVTNGEM 60 Query: 60 MAEICDKYKVNTIVNLAALLSAVAEAKPQLAYDINMNGLFNILEIAREKNISVFTPSSIA 119 + + +Y ++TI NLAALLS VAE+KP+LA+ I ++GL+N+LE+ARE+ +VFTPSSI Sbjct: 61 IESVVKEYHIDTIYNLAALLSVVAESKPKLAWKIGIDGLWNVLEVAREQGCAVFTPSSIG 120 Query: 120 AFGPSTPPDNTPQDTIQRPTTMYGVTKVAGELLCDYYYKRFGVDTRGVRFPGLISYKALP 179 +FG STP TPQDTIQRP TMYGVTKV ELL DYY+ ++GVDTR VRFPG+IS P Sbjct: 121 SFGASTPHTQTPQDTIQRPRTMYGVTKVTTELLSDYYFNKYGVDTRAVRFPGIISNVTPP 180 Query: 180 GGGTTDYAVHIYYEALKAKKYASFIDKGTMMDMMYMPDAIKAIHDLMEANPDKLVHRNAF 239 GGGTTDYAV IYY A++ +K+ I +GT+MDMMYMPDA+ A LMEA+P KL+HRNAF Sbjct: 181 GGGTTDYAVDIYYSAVRGEKFVCPIKEGTLMDMMYMPDALNAAIMLMEADPTKLIHRNAF 240 Query: 240 NVTAMSFDPEILAGEIRKHIPEFELSYDVDPVKQAIANSWPNSLDDSCAREEWNWKPDYT 299 N+ +MSFDPE + I+KH+P FE+ YDVDP+KQ IA+SWP+SLDD+CAREEW WKP Y Sbjct: 241 NIASMSFDPETIFHAIKKHVPAFEMIYDVDPLKQRIADSWPDSLDDTCAREEWGWKPAYD 300 Query: 300 MESMTKDMLEKLSEKL 315 +ESMT DMLEKL EKL Sbjct: 301 LESMTVDMLEKLREKL 316 Lambda K H 0.317 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 318 Length adjustment: 27 Effective length of query: 292 Effective length of database: 291 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory