Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate 353143 BT3617 sorbitol dehydrogenase (NCBI ptt file)
Query= curated2:Q8R7K0 (347 letters) >FitnessBrowser__Btheta:353143 Length = 338 Score = 131 bits (330), Expect = 2e-35 Identities = 88/274 (32%), Positives = 138/274 (50%), Gaps = 8/274 (2%) Query: 19 IVKKEIPKIGPDEVLIKVKATSICGTDVHIYVWNEWAKSRIKPPKTMGHEFVGEVVEIGE 78 +V+ E P +G EVL+++K CG+D++ ++ +K P GHE + EIG Sbjct: 14 VVELEKPTVGAGEVLVRIKYVGFCGSDLNTFLGRN---PMVKLPVIPGHEVGAVIEEIGP 70 Query: 79 NVTS-VKVGDLVSAETHIVCGKCRACRTGNAHICENTLILGVDTDGAFAEYIKVPESNVW 137 +V + + G V+ + CGKC +CR G + CE+ LGV +G EY +P + + Sbjct: 71 DVPAGFEKGMNVTLNPYTNCGKCASCRNGRVNACEHNETLGVQRNGVMCEYAVLPWTKI- 129 Query: 138 INDKNIPLEILSIQEPLGNAVHTVFSGDVVGKS-VAVIGCGPIGMMAIPLLKRTGAAAIF 196 I NI ++ EP+ H V V+ V VIGCG IG+ AI GA I Sbjct: 130 IPAGNISSRDCALIEPMSVGFHAVSRAQVIDNEYVMVIGCGMIGIGAIVRAALRGATVI- 188 Query: 197 AIEPADYRRELAHKLGATRVINPLREDVVSIIKSETEGYGADVVLDFSGNPTAIRQGLEY 256 A++ D + LA ++GA+ +N E+V I+ T G+GADVV++ G+P ++ Sbjct: 189 AVDLDDEKLVLAKRVGASYAVNSKTENVHERIQEITAGFGADVVIEAVGSPVTYVMAVDE 248 Query: 257 IAKGGRMSILGLPDNEVPIDITNNVVFKGITIQG 290 + GR+ +G EV T V K + I+G Sbjct: 249 VGFTGRVVCIGYAKKEVAFQ-TKYFVQKELDIRG 281 Lambda K H 0.319 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 338 Length adjustment: 29 Effective length of query: 318 Effective length of database: 309 Effective search space: 98262 Effective search space used: 98262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory