Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate 354038 BT4512 putative zinc-type alcohol dehydrogenase (NCBI ptt file)
Query= curated2:Q67N85 (351 letters) >FitnessBrowser__Btheta:354038 Length = 350 Score = 122 bits (305), Expect = 2e-32 Identities = 101/333 (30%), Positives = 154/333 (46%), Gaps = 16/333 (4%) Query: 19 LQEVPIPTI-GPRDVLVKVRAASICGTDYHIYTWDPWSAGRVKPPLTIGHELAGEVVAVG 77 L+E P P I RD +V+V SIC +D HI S R P +T+GHE+ G V VG Sbjct: 14 LREKPEPKITDARDAIVRVTLGSICTSDLHI---KHGSVPRAVPGITVGHEMVGVVEEVG 70 Query: 78 REVTACKVGDYVSAETHIVCNRCPRCHMGEYHLCENTK---ILGVDTDGAFAEYVAVPEQ 134 EVT+ + GD V+ C C CH G + C + LG DG AEYV VP Sbjct: 71 AEVTSVRPGDRVTVNVETFCGECFFCHHGYVNNCTDPNGGWALGCRIDGGQAEYVRVPYA 130 Query: 135 NIWVN---DKDIPFELQSIQEPLGNAVHTALNGDLTAR-SVLITGCGPIGIMSVPVAKMA 190 + +N D + + + L ++T + ++L+ G GP GI ++ + + Sbjct: 131 DQGLNRIPDTVSDEQALFVGDVLATGFWATRISEITEKDTILLIGAGPTGICTLLCSMLK 190 Query: 191 GAEIVMAMDINEYRLQLAGQLGADVLINPTKQDPVEVVRSYTRGYGADVVLEMSGNPTAI 250 + ++ + + R+Q + DVLI T ++ E V + GADVVLE++G + Sbjct: 191 NPKRIIVCEKSPERIQFVREHYPDVLIT-TPENCKEFVLQNSDHSGADVVLEVAGTEDSF 249 Query: 251 RQGLKAARNGARISLLGLPGRPLELDLAADVIMRGLVLQGITGRRMWQTWYQVRSLYRAG 310 R AR A ++++ L +PL L M G L TG ++ SL G Sbjct: 250 RMAWDCARPNAIVTIVALYDKPLLFPLPE---MYGKNLTFKTGGVDGCDCAEILSLIEEG 306 Query: 311 LAERLRPLVTHRMPLEQIDAAMELMGSGQSGKI 343 + PL+THR L +I+ A + + G I Sbjct: 307 KID-TTPLITHRCSLNEIEEAYRIFENKLDGVI 338 Lambda K H 0.320 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 350 Length adjustment: 29 Effective length of query: 322 Effective length of database: 321 Effective search space: 103362 Effective search space used: 103362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory