GapMind for catabolism of small carbon sources

 

Aligments for a candidate for TRET1 in Bacteroides thetaiotaomicron VPI-5482

Align Facilitated trehalose transporter Tret1; BmTRET1 (characterized)
to candidate 353923 BT4397 xylose/H+ symporter (NCBI ptt file)

Query= SwissProt::A9ZSY3
         (505 letters)



>lcl|FitnessBrowser__Btheta:353923 BT4397 xylose/H+ symporter (NCBI
           ptt file)
          Length = 460

 Score =  189 bits (479), Expect = 2e-52
 Identities = 127/412 (30%), Positives = 214/412 (51%), Gaps = 35/412 (8%)

Query: 99  LAALVGGIVGGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVVMVF-AGRVICGVCVGI 157
           L  L+G +V G + +  GRK  ++ +A  F +       A +V   F A R + G+ +GI
Sbjct: 59  LGCLIGAMVAGMMADRYGRKPLLLISAFIF-LSSAYATGAFSVFSWFLAARFLGGIGIGI 117

Query: 158 VSLAFPVYIGETIQPEVRG---ALGLLPTAFGNTGILLA-FLVGSYL-----------DW 202
            S   P+YI E     +RG   +L  L    G  G  +A +L+   +            W
Sbjct: 118 ASGLSPMYIAEVAPTSIRGKLVSLNQLTIVLGILGAQIANWLIAEPIPADFTPADICASW 177

Query: 203 SNLA-----FFGAAIPVPFFLLMI-LTPETPRWYVSKARVQEARKSLRWLRGKNVNIEKE 256
           +        F+GAA P   FLL+    PE+PRW   K + ++A   L  + G N   E+E
Sbjct: 178 NGQMGWRWMFWGAAFPAAVFLLLACFIPESPRWLAMKGKREKAWSVLSRIGG-NRYAEQE 236

Query: 257 MRDLTISQTESDRTGGNAFKQLFSKRYLPAVMISLGLMLFQQLTGINAVIFYAASIFQMS 316
           ++   + QT + ++ G   K LFS+ +   +++ + + +FQQ  G N +  YA  IFQ +
Sbjct: 237 LQ--MVEQTSASKSEGG-LKLLFSRPFRKVLVLGVIVAVFQQWCGTNVIFNYAQEIFQSA 293

Query: 317 GSSVDENLASIII-GVVNFISTFIATMLIDRLGRKVLLYISSVAMITTLLALGAYFYLKQ 375
           G S+ + L +I++ GV N I TF+A   ++RLGR+ L+ + +  +    L LG  ++ + 
Sbjct: 294 GYSLGDVLFNIVVTGVANVIFTFVAIYTVERLGRRALMLLGAGGLAGIYLVLGTCYFFQV 353

Query: 376 NHIDVTAYGWLPLACLVIYVLGFSIGFGPIPWLMLGEILPSKIRGTAASLATGFNWTCTF 435
           +       G+  +  +V+ +  +++  GPI W++L EI P+++RG A +  T   W  +F
Sbjct: 354 S-------GFFMVVLVVLAIACYAMSLGPITWVLLAEIFPNRVRGVAMATCTFALWVGSF 406

Query: 436 IVTKTFQNIIDAIYMHGTLWLFAVICIGGLLFVIFFVPETKGKSLEEIEMKL 487
            +T TF  +  A+  +GT W+++ IC+ G LF +  +PETKGKSLE +E  L
Sbjct: 407 TLTYTFPLLNTALGSYGTFWIYSAICVFGFLFFLRALPETKGKSLETLEKDL 458



 Score = 44.7 bits (104), Expect = 7e-09
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 313 FQMSGSSVDENLASIIIGVVNFISTFIATMLIDRLGRKVLLYISSVAMITTLLALGAYFY 372
           F ++ S   + LA  +  +   I   +A M+ DR GRK LL IS+   +++  A GA+  
Sbjct: 41  FGIADSPTMQGLAMSVALLGCLIGAMVAGMMADRYGRKPLLLISAFIFLSSAYATGAF-- 98

Query: 373 LKQNHIDVTAYGWLPLACLVIYVLGFSIGFGPIPWLMLGEILPSKIRGTAASL 425
                   + + W  LA   +  +G  I  G  P + + E+ P+ IRG   SL
Sbjct: 99  --------SVFSWF-LAARFLGGIGIGIASGLSP-MYIAEVAPTSIRGKLVSL 141


Lambda     K      H
   0.325    0.140    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 615
Number of extensions: 35
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 505
Length of database: 460
Length adjustment: 34
Effective length of query: 471
Effective length of database: 426
Effective search space:   200646
Effective search space used:   200646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory