Align TreV, component of Trehalose porter (characterized)
to candidate 353365 BT3839 ABC transporter ATP-binding protein (NCBI ptt file)
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__Btheta:353365 Length = 256 Score = 124 bits (311), Expect = 2e-33 Identities = 70/218 (32%), Positives = 119/218 (54%), Gaps = 10/218 (4%) Query: 3 VELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIAD 62 +++ + K + V++ I E G+ +I+G SG GK+ L+K + G+ +KG+++ D Sbjct: 2 IDIRGLYKSFEDKTVLSNINASFENGKTNLIIGQSGSGKTVLMKCIVGLLTPEKGEVLYD 61 Query: 63 GADIT-----DKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAA 117 G ++ +K ++ + M+FQ+ AL+ +MSV DN+ FPL M + + +R ++A Sbjct: 62 GRNLVLMGKKEKKMLRKEMGMIFQSAALFDSMSVLDNVMFPLNM--FSNDTLRDRTKRAM 119 Query: 118 KLL---GISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGE 174 L ++E DK +ISGG Q+RVA+ARAI NP Y DEP S LD + Sbjct: 120 FCLERVNLTEAKDKFPGEISGGMQKRVAIARAIALNPQYLFCDEPNSGLDPKTSLVIDDL 179 Query: 175 LKRIQKELKGTFIYVTHDQKEALSLADRIAILHKGKFE 212 + I +E T I THD L + +++ +++G E Sbjct: 180 IHDITQEYNMTTIINTHDMNSVLGIGEKVIYIYEGHKE 217 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 256 Length adjustment: 26 Effective length of query: 298 Effective length of database: 230 Effective search space: 68540 Effective search space used: 68540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory