Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate 350819 BT1291 spermidine/putrescine transport ATP-binding protein (NCBI ptt file)
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Btheta:350819 Length = 463 Score = 220 bits (561), Expect = 6e-62 Identities = 133/346 (38%), Positives = 192/346 (55%), Gaps = 13/346 (3%) Query: 13 YAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLP 72 + G L + L++ GEFV +LGPSGCGK+T+LR+IAG + S G +RI G + P Sbjct: 18 FFGDKTALDDVTLNVKKGEFVTILGPSGCGKTTLLRLIAGFQTASEGEIRISGKEITQTP 77 Query: 73 ARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKP 132 +R V VFQ YAL+PH++VYDNIAFGL+ K P I ++V+ ++ + R Sbjct: 78 PHKRPVNTVFQKYALFPHLNVYDNIAFGLKLKKTPKQTIGKKVKAALKMVGMTDYEYRDV 137 Query: 133 RAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVT 192 ++SGGQQQR AIARAI+ P V L DEPL+ LD K+R ++ ++K +H+ L T VYVT Sbjct: 138 DSLSGGQQQRVAIARAIVNEPEVLLLDEPLAALDLKMRKDMQMELKEMHKSLGITFVYVT 197 Query: 193 HDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNFLSGTVQRQDG 252 HDQ EA+TL+D +++M +G+I Q G+P ++Y P N F A FIG N L+GT+ Sbjct: 198 HDQEEALTLSDTIVVMSEGKIQQIGTPIDIYNEPINSFVADFIG--ESNILNGTMIHDKL 255 Query: 253 QLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAASLTCPVSVELVEIL 312 F T + E F V + +RP+ + I E A LT V + + Sbjct: 256 VRFCGT---EFECVDEGFG---ENTPVDVVIRPEDLYIFPVSE-MAQLTGVVQTSIFK-- 306 Query: 313 GADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHELHVFDVE 358 G +T CG LV + GA + L + ++H+ E Sbjct: 307 GVHYEMTVLCGGYEF--LVQDYHHFEVGAEVGLLVKPFDIHIMKKE 350 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 463 Length adjustment: 32 Effective length of query: 374 Effective length of database: 431 Effective search space: 161194 Effective search space used: 161194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory