Align SDR family oxidoreductase (characterized, see rationale)
to candidate 351439 BT1911 7-alpha-hydroxysteroid dehydrogenase (NCBI ptt file)
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Btheta:351439 Length = 259 Score = 124 bits (310), Expect = 3e-33 Identities = 86/257 (33%), Positives = 130/257 (50%), Gaps = 23/257 (8%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASI-----AGVETHLL 61 R K V+IT AA GIG A+T EG +V+ D+S+ ++LA+ A V Sbjct: 3 RFENKVVVITGAAGGIGEATTRRIVSEGGKVVIADLSQERADKLAAELTQAGADVRPIYF 62 Query: 62 DVTDDDAIKALV----AKVGTVDVLFNCAGYVAAG---NILECDDKAWDFSFNLNAKAMF 114 T+ + K LV + G +DVL N G NI + D +D F+LN Sbjct: 63 SATELQSCKELVDFAMKEYGQIDVLINNVGGTDPKRDLNIEKLDIDYFDEVFHLNLCCTM 122 Query: 115 HTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGI 174 + + V+P M G+IVN+AS S + AN YGASKA V+ LTK +A + I Sbjct: 123 YLSQQVIPIMTTHGGGNIVNVASI-SGLTADANGTLYGASKAGVINLTKYIATQMGKKNI 181 Query: 175 RCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLA 234 RCNA+ PG + +P+ ++ +EVR F+ + +G+ E+VAA +LA Sbjct: 182 RCNAVAPGLVLTPAALDNLN----------EEVRNIFLGQCATPYLGEPEDVAATIAFLA 231 Query: 235 SDESNFTTGSIHMIDGG 251 S+++ + TG ++DGG Sbjct: 232 SNDARYITGQTIVVDGG 248 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 259 Length adjustment: 24 Effective length of query: 230 Effective length of database: 235 Effective search space: 54050 Effective search space used: 54050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory