GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xad in Bacteroides thetaiotaomicron VPI-5482

Align xylonate dehydratase (EC 4.2.1.82) (characterized)
to candidate 351606 BT2078 dihydroxy-acid dehydratase (NCBI ptt file)

Query= BRENDA::P39358
         (655 letters)



>lcl|FitnessBrowser__Btheta:351606 BT2078 dihydroxy-acid dehydratase
           (NCBI ptt file)
          Length = 600

 Score =  206 bits (523), Expect = 3e-57
 Identities = 175/542 (32%), Positives = 266/542 (49%), Gaps = 62/542 (11%)

Query: 78  GKPVALALHQ------GHYEL-DIQMKAAAEVIKAN-HALPYAVYVSDPCDGRTQGTTGM 129
           GKP+   ++       GH  L +I     AE+ K    A  +     D  DG   G  GM
Sbjct: 34  GKPIIAIVNSFTQFVPGHVHLHEIGQLVKAEIEKLGCFAAEFNTIAID--DGIAMGHDGM 91

Query: 130 FDSLPYRNDASMVMRRLIRSLPDAKAVIGVASCDKGLPATMMALAAQHNIATVLVPGGAT 189
             SLP R+  +  +  ++ +   A A++ +++CDK  P  +MA A + NI TV V GG  
Sbjct: 92  LYSLPSRDIIADSVEYMVNA-HKADAMVCISNCDKITPGMLMA-AMRLNIPTVFVSGG-- 147

Query: 190 LPAKDGEDNGK-VQTIGARFANGELSLQDARRAGCK--ACASSGGGCQFLGTAGTSQVVA 246
            P + GE NG+ +  I A   + + S+ D   A  +  AC + G  C  + TA +   + 
Sbjct: 148 -PMEAGEWNGQHLDLIDAMIKSADDSVSDQEVANIEQNACPTCGC-CSGMFTANSMNCLN 205

Query: 247 EGLGLAIPHS----ALAPSGEPVWREIARASARAALNLSQKG---ITTREILTDKAIENA 299
           E +GLA+P +    A   +   ++ + A+     A+   ++G   +  R I T +A  NA
Sbjct: 206 EAIGLALPGNGTIVATHENRTKLFEDAAKLIVENAMKYYEEGDESVLPRSIATRQAFLNA 265

Query: 300 MTVHAAFGGSTNLLLHIPAIAHQAGCHIPTVDDWIRINKRVPRLVSVLPNGPVYHPTVNA 359
           MT+  A GGSTN +LH+ A+AH+AG     +DD   ++++ P L  V PN   YH   + 
Sbjct: 266 MTLDIAMGGSTNTVLHLLAVAHEAGVDFK-MDDIDMLSRKTPCLCKVAPNTQKYH-IQDV 323

Query: 360 FMAGGVPEVMLHLRSLGLLHEDVMTVTGSTLKENLDWWE--------------HSERRQR 405
             AGG+  ++  L   GL+   V+ V G +L E +D +                S    R
Sbjct: 324 NRAGGIIAILAELAKGGLIDTSVLRVDGMSLAEAIDQYSITSPNVTEKAMSKYSSAAGNR 383

Query: 406 FKQLL---------LDQEQINADEVIMSPQQAKARGLTSTITFPVGNIAPEGSVIKSTAI 456
           F  +L         LD+++ N     +    +K  GL        GNIA +G V+K+  +
Sbjct: 384 FNLVLGSQGAYYQELDKDRANGCIRDLEHAYSKDGGLAVL----KGNIAQDGCVVKTAGV 439

Query: 457 DPSMIDEQGIYYHKGVAKVYLSEKSAIYDIKHDKIKAGDILVIIGVGPSG-TGMEETYQV 515
           D S      I+   G AKV+ S+++A   I   ++ +GD++VI   GP G  GM+E    
Sbjct: 440 DES------IWKFTGPAKVFDSQEAACEGILGGRVVSGDVVVITHEGPKGGPGMQEMLYP 493

Query: 516 TSALKHLSYGKHVSLITDARFSGVSTGACIGHVGPEALAGGPIGKLRTGDLIEIKIDCRE 575
           TS +K    GK  +LITD RFSG ++G  IGHV PEA AGG IGK+  GD+IEI I  R 
Sbjct: 494 TSYIKSRHLGKECALITDGRFSGGTSGLSIGHVSPEAAAGGNIGKIVDGDIIEIDIPART 553

Query: 576 LH 577
           ++
Sbjct: 554 IN 555


Lambda     K      H
   0.317    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 899
Number of extensions: 42
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 655
Length of database: 600
Length adjustment: 38
Effective length of query: 617
Effective length of database: 562
Effective search space:   346754
Effective search space used:   346754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory