Protein H281DRAFT_02565 in Paraburkholderia bryophila 376MFSha3.1
Annotation: FitnessBrowser__Burk376:H281DRAFT_02565
Length: 241 amino acids
Source: Burk376 in FitnessBrowser
Candidate for 17 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-asparagine catabolism | aatP | hi | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 69% | 100% | 339.3 | uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ | 59% | 279.3 |
L-aspartate catabolism | aatP | hi | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 69% | 100% | 339.3 | uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ | 59% | 279.3 |
L-glutamate catabolism | gltL | hi | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 69% | 100% | 339.3 | uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ | 59% | 279.3 |
L-lysine catabolism | hisP | med | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 58% | 93% | 278.1 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-asparagine catabolism | aapP | med | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 56% | 93% | 267.7 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-aspartate catabolism | aapP | med | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 56% | 93% | 267.7 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-glutamate catabolism | aapP | med | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 56% | 93% | 267.7 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-histidine catabolism | aapP | med | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 56% | 93% | 267.7 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-leucine catabolism | aapP | med | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 56% | 93% | 267.7 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-proline catabolism | aapP | med | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 56% | 93% | 267.7 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
D-alanine catabolism | Pf6N2E2_5405 | med | ABC transporter for D-Alanine, ATPase component (characterized) | 57% | 95% | 266.9 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-asparagine catabolism | bztD | med | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 57% | 91% | 265.8 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-aspartate catabolism | bztD | med | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 57% | 91% | 265.8 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-asparagine catabolism | bgtA | med | ATPase (characterized, see rationale) | 55% | 92% | 249.2 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-aspartate catabolism | bgtA | med | ATPase (characterized, see rationale) | 55% | 92% | 249.2 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-asparagine catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 53% | 99% | 235 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
L-aspartate catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 53% | 99% | 235 | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter | 69% | 339.3 |
Sequence Analysis Tools
View H281DRAFT_02565 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MIDLNNVSKWYGGIRVLNHCTASIARGEVAVICGPSGSGKSTLIKSVNGLEAVQSGQIVV
DGIDVTAKRANLSRLRTRVGMVFQHFELFPHLSVQRNLMLAQMNVLGRARDEAGERARSL
LRRVGLSGHEDKYPAQLSGGQQQRVAIARALSMDPVAMLFDEPTSALDPEMVNEVLDVMT
TLAQDGMTMLCVTHEMGFAKRVADRVLFMDRGVIVEDETREAFFERPRSERARDFLSRIL
H
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory