GapMind for catabolism of small carbon sources

 

Protein H281DRAFT_03016 in Paraburkholderia bryophila 376MFSha3.1

Annotation: H281DRAFT_03016 aldehyde dehydrogenase (acceptor)

Length: 483 amino acids

Source: Burk376 in FitnessBrowser

Candidate for 21 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-phenylalanine catabolism pad-dh med aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized) 47% 89% 429.5 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-arginine catabolism kauB med 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 45% 99% 405.6 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-arginine catabolism puuC med 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 45% 99% 405.6 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-citrulline catabolism puuC med 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 45% 99% 405.6 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
putrescine catabolism puuC med 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized) 45% 99% 405.6 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-fucose catabolism aldA med NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized) 43% 92% 398.3 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-rhamnose catabolism aldA med NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized) 43% 92% 398.3 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-threonine catabolism aldA med NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized) 43% 92% 398.3 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-arginine catabolism patD med 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized) 43% 96% 391.7 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-citrulline catabolism patD med 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized) 43% 96% 391.7 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
putrescine catabolism patD med 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized) 43% 96% 391.7 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
4-hydroxybenzoate catabolism praB med 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized) 42% 96% 379.4 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-tryptophan catabolism praB med 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized) 42% 96% 379.4 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-lysine catabolism patD lo aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized) 39% 99% 344 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-tryptophan catabolism nbaE lo 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 (characterized) 40% 97% 341.7 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-arginine catabolism putA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 36% 90% 280.8 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-arginine catabolism rocA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 36% 90% 280.8 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-citrulline catabolism putA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 36% 90% 280.8 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-citrulline catabolism rocA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 36% 90% 280.8 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-proline catabolism putA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 36% 90% 280.8 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1
L-lysine catabolism amaB lo aldehyde dehydrogenase (NAD+) (EC 1.2.1.3); L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31) (characterized) 32% 85% 222.2 cumic aldehyde dehydrogenase (EC 1.2.1.29) 52% 491.1

Sequence Analysis Tools

View H281DRAFT_03016 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MDTDTGLRRHDLLIDGKRLPPGTGEYSVNINPATEEPIAHVAQGSAADVDTAVRAARAAL
KVWNGIKAAERGRILSRLAGLMRANLDELAALESLDAGKPIAAVMRQDVPAAIDTLEYYA
GWCDKINGQVVPVRPDALTYTLREPVGVVAAIVPWNFPLMIGMWKIAPALACGCTLIVKP
AEITPLSALRIGELALEAGVPPGVLNIVTGKGRVVGDALVAHPGVDKVTFTGSPSVGRGI
LQGAAGNFKRVTLELGGKSANLIFPDANLDNAVRAAASGIFFNTGQVCSAGSRILAHRDV
YDEVVERLAARAKSIKVGDPSSRETSMGPLISAAQMKTVLGYVDAGRSEGASLVTGGGRI
GERGFFVEPTVFANVEHEMRISQEEIFGPVASVIRFNDEADAIRIANGTLYSLAAGVWSA
DIGRVHRVARDLRAGTVWINTYGYTDVRLPWGGSGDSGFGREHGDVAIENFTEPKAVWLA
IDQ

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory